Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HJG8

Protein Details
Accession A0A1A0HJG8    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-35SDDGWKVQGRKRRNSRKRPERSVTMAHydrophilic
NLS Segment(s)
PositionSequence
18-29GRKRRNSRKRPE
Subcellular Location(s) nucl 15.5, cyto_nucl 11.333, cyto 6, cyto_mito 5.333, mito 3.5
Family & Domain DBs
Amino Acid Sequences MSDILVSNISDDGWKVQGRKRRNSRKRPERSVTMATTPGLILTDQKGSLGSYPSMKQPSSNSNPFLVLAEISEEDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.21
4 0.29
5 0.37
6 0.47
7 0.56
8 0.64
9 0.73
10 0.81
11 0.88
12 0.91
13 0.93
14 0.93
15 0.88
16 0.84
17 0.79
18 0.74
19 0.65
20 0.56
21 0.46
22 0.36
23 0.3
24 0.22
25 0.16
26 0.1
27 0.07
28 0.06
29 0.06
30 0.07
31 0.06
32 0.07
33 0.07
34 0.07
35 0.08
36 0.1
37 0.09
38 0.11
39 0.12
40 0.17
41 0.2
42 0.2
43 0.21
44 0.23
45 0.32
46 0.37
47 0.42
48 0.39
49 0.38
50 0.39
51 0.37
52 0.34
53 0.26
54 0.18
55 0.12
56 0.12
57 0.11