Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0H580

Protein Details
Accession A0A1A0H580    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MANSLRSKPKLRAKSVKRKGEFTKHydrophilic
71-92GRSAAARKKMKVKKSRNKKLKFBasic
NLS Segment(s)
PositionSequence
7-19SKPKLRAKSVKRK
73-92SAAARKKMKVKKSRNKKLKF
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MANSLRSKPKLRAKSVKRKGEFTKFVDDRNARLAEKTRLNLQKQNEEKMAEDTPIEEASEDAASKISNTSGRSAAARKKMKVKKSRNKKLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.89
4 0.83
5 0.81
6 0.8
7 0.79
8 0.75
9 0.68
10 0.69
11 0.59
12 0.57
13 0.58
14 0.51
15 0.42
16 0.41
17 0.39
18 0.28
19 0.29
20 0.31
21 0.28
22 0.31
23 0.31
24 0.33
25 0.37
26 0.4
27 0.43
28 0.42
29 0.45
30 0.44
31 0.46
32 0.4
33 0.34
34 0.32
35 0.3
36 0.27
37 0.18
38 0.16
39 0.12
40 0.11
41 0.11
42 0.1
43 0.06
44 0.06
45 0.06
46 0.07
47 0.06
48 0.05
49 0.06
50 0.05
51 0.06
52 0.06
53 0.07
54 0.1
55 0.11
56 0.14
57 0.15
58 0.16
59 0.19
60 0.24
61 0.3
62 0.37
63 0.42
64 0.45
65 0.54
66 0.61
67 0.69
68 0.74
69 0.78
70 0.79
71 0.84
72 0.91