Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HJ46

Protein Details
Accession A0A1A0HJ46    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
10-35SDDGWKVQGRKRRNSRKRPERSVTMAHydrophilic
NLS Segment(s)
PositionSequence
18-29GRKRRNSRKRPE
Subcellular Location(s) nucl 16.5, cyto_nucl 11.333, cyto 5, cyto_mito 4.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MSDILVSNISDDGWKVQGRKRRNSRKRPERSVTMATAPGLILTDQKGSLGSYPSMKQPSSNLNPFLVLAEISEEDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.21
4 0.29
5 0.37
6 0.47
7 0.56
8 0.64
9 0.73
10 0.81
11 0.88
12 0.91
13 0.93
14 0.93
15 0.88
16 0.84
17 0.79
18 0.73
19 0.63
20 0.54
21 0.44
22 0.34
23 0.27
24 0.2
25 0.13
26 0.09
27 0.07
28 0.05
29 0.05
30 0.06
31 0.05
32 0.06
33 0.06
34 0.06
35 0.07
36 0.09
37 0.09
38 0.11
39 0.12
40 0.17
41 0.2
42 0.2
43 0.2
44 0.22
45 0.3
46 0.35
47 0.4
48 0.37
49 0.35
50 0.35
51 0.34
52 0.32
53 0.23
54 0.15
55 0.1
56 0.1
57 0.1