Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HIJ8

Protein Details
Accession A0A1A0HIJ8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-60SRGQERCQRGSQKKSQHKEVKEEANKEVKKELKKRGQHKDFKKEVSKBasic
NLS Segment(s)
PositionSequence
27-61KSQHKEVKEEANKEVKKELKKRGQHKDFKKEVSKE
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 10
Family & Domain DBs
Amino Acid Sequences MKRIRCPGLGAIYSRGQERCQRGSQKKSQHKEVKEEANKEVKKELKKRGQHKDFKKEVSKEVKEEVNKVNKELKKEFKEEVSKEVKEEVNEVNKELKNEVKEEANKEADKEVNKEVNEEANKEADKDVNKEVNEEVNESQQRGQQRGQQRIEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.28
4 0.33
5 0.37
6 0.39
7 0.44
8 0.53
9 0.59
10 0.67
11 0.72
12 0.76
13 0.8
14 0.81
15 0.83
16 0.82
17 0.78
18 0.77
19 0.76
20 0.76
21 0.72
22 0.68
23 0.63
24 0.64
25 0.6
26 0.53
27 0.51
28 0.47
29 0.49
30 0.53
31 0.58
32 0.58
33 0.65
34 0.73
35 0.78
36 0.82
37 0.83
38 0.84
39 0.85
40 0.81
41 0.8
42 0.79
43 0.71
44 0.68
45 0.68
46 0.61
47 0.53
48 0.49
49 0.47
50 0.4
51 0.41
52 0.39
53 0.37
54 0.35
55 0.35
56 0.4
57 0.36
58 0.41
59 0.43
60 0.45
61 0.41
62 0.44
63 0.43
64 0.41
65 0.46
66 0.41
67 0.42
68 0.4
69 0.35
70 0.32
71 0.34
72 0.29
73 0.23
74 0.24
75 0.2
76 0.21
77 0.21
78 0.22
79 0.25
80 0.25
81 0.25
82 0.24
83 0.25
84 0.2
85 0.21
86 0.22
87 0.22
88 0.24
89 0.27
90 0.3
91 0.31
92 0.3
93 0.29
94 0.3
95 0.28
96 0.27
97 0.27
98 0.27
99 0.28
100 0.28
101 0.28
102 0.27
103 0.31
104 0.3
105 0.29
106 0.25
107 0.24
108 0.24
109 0.23
110 0.23
111 0.2
112 0.21
113 0.23
114 0.28
115 0.3
116 0.3
117 0.31
118 0.31
119 0.33
120 0.31
121 0.31
122 0.26
123 0.28
124 0.3
125 0.3
126 0.31
127 0.28
128 0.32
129 0.33
130 0.35
131 0.35
132 0.43
133 0.51