Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HDS0

Protein Details
Accession A0A1A0HDS0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-60HDGWKVQGRKRRNSRKRPEPSVIMBasic
NLS Segment(s)
PositionSequence
44-54GRKRRNSRKRP
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSLQESIQDVEEDPHMGSKQVRTTVEMSDSLVSDISHDGWKVQGRKRRNSRKRPEPSVIMATTTGPRKGSLGSNPSMKNPSFNVNPFLVLAEISEEDFQQATPRRYLCLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.15
5 0.17
6 0.22
7 0.26
8 0.27
9 0.27
10 0.29
11 0.29
12 0.3
13 0.26
14 0.22
15 0.18
16 0.17
17 0.14
18 0.13
19 0.1
20 0.08
21 0.09
22 0.09
23 0.08
24 0.08
25 0.08
26 0.1
27 0.15
28 0.2
29 0.25
30 0.31
31 0.37
32 0.48
33 0.59
34 0.68
35 0.73
36 0.79
37 0.84
38 0.88
39 0.9
40 0.87
41 0.81
42 0.73
43 0.66
44 0.6
45 0.5
46 0.39
47 0.3
48 0.24
49 0.22
50 0.19
51 0.17
52 0.12
53 0.12
54 0.12
55 0.13
56 0.16
57 0.18
58 0.21
59 0.23
60 0.29
61 0.3
62 0.32
63 0.34
64 0.31
65 0.28
66 0.26
67 0.29
68 0.27
69 0.28
70 0.3
71 0.26
72 0.27
73 0.24
74 0.23
75 0.17
76 0.12
77 0.1
78 0.08
79 0.08
80 0.08
81 0.09
82 0.08
83 0.09
84 0.09
85 0.09
86 0.14
87 0.21
88 0.23
89 0.28
90 0.29
91 0.32