Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YNG2

Protein Details
Accession C7YNG2    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-32PLKLRSSCTRLRKCTARRKVLFQLLYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 4
Family & Domain DBs
KEGG nhe:NECHADRAFT_92167  -  
Amino Acid Sequences MPRLQTPLKLRSSCTRLRKCTARRKVLFQLLYPIPWHFPVPMQRSPSDYDSIDTSSLQPNILQLHNIPLYRLRDTPVRSLYRLYEDLCSGNLIMMGYESDYFFYHTENSWQLSQVPDPRDTDPIRYAVLASLVEALVSAFNWKLEQGLRRDGTHNADGSRAVVHLQARPTWTAQAQPLLERLNLGASEKDGADPDFLKRNIEAPMGYLYCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.68
3 0.66
4 0.72
5 0.78
6 0.79
7 0.83
8 0.85
9 0.85
10 0.8
11 0.81
12 0.82
13 0.81
14 0.74
15 0.64
16 0.61
17 0.52
18 0.48
19 0.41
20 0.33
21 0.25
22 0.24
23 0.23
24 0.16
25 0.19
26 0.26
27 0.31
28 0.35
29 0.38
30 0.37
31 0.4
32 0.43
33 0.41
34 0.36
35 0.3
36 0.25
37 0.23
38 0.24
39 0.21
40 0.18
41 0.16
42 0.17
43 0.17
44 0.15
45 0.13
46 0.13
47 0.16
48 0.15
49 0.14
50 0.11
51 0.15
52 0.18
53 0.18
54 0.17
55 0.19
56 0.22
57 0.23
58 0.24
59 0.21
60 0.24
61 0.27
62 0.32
63 0.35
64 0.34
65 0.33
66 0.34
67 0.33
68 0.32
69 0.31
70 0.27
71 0.2
72 0.18
73 0.18
74 0.16
75 0.15
76 0.1
77 0.08
78 0.07
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.06
89 0.07
90 0.07
91 0.08
92 0.07
93 0.1
94 0.1
95 0.12
96 0.11
97 0.11
98 0.11
99 0.11
100 0.14
101 0.17
102 0.18
103 0.18
104 0.2
105 0.21
106 0.26
107 0.25
108 0.26
109 0.23
110 0.22
111 0.2
112 0.18
113 0.17
114 0.12
115 0.12
116 0.09
117 0.07
118 0.06
119 0.06
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.05
129 0.05
130 0.06
131 0.09
132 0.14
133 0.17
134 0.25
135 0.27
136 0.28
137 0.31
138 0.32
139 0.35
140 0.33
141 0.32
142 0.24
143 0.23
144 0.22
145 0.2
146 0.18
147 0.12
148 0.1
149 0.1
150 0.12
151 0.14
152 0.16
153 0.17
154 0.19
155 0.21
156 0.21
157 0.22
158 0.21
159 0.21
160 0.22
161 0.25
162 0.24
163 0.24
164 0.26
165 0.25
166 0.24
167 0.21
168 0.19
169 0.15
170 0.15
171 0.15
172 0.12
173 0.11
174 0.13
175 0.13
176 0.13
177 0.12
178 0.13
179 0.14
180 0.14
181 0.17
182 0.24
183 0.24
184 0.25
185 0.25
186 0.26
187 0.27
188 0.29
189 0.25
190 0.19
191 0.25