Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HDA2

Protein Details
Accession A0A1A0HDA2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
325-357AEWERREKARLDRREKRYQAKMREMRKKTRAEEBasic
NLS Segment(s)
PositionSequence
329-355RREKARLDRREKRYQAKMREMRKKTRA
Subcellular Location(s) nucl 13, cyto 6, pero 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009061  DNA-bd_dom_put_sf  
IPR000465  XPA  
IPR022656  XPA_C  
IPR037129  XPA_sf  
IPR022652  Znf_XPA_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0046872  F:metal ion binding  
GO:0006289  P:nucleotide-excision repair  
Pfam View protein in Pfam  
PF05181  XPA_C  
PF01286  XPA_N  
CDD cd21077  DBD_Rad14  
Amino Acid Sequences MAGLTDEQRKRIDENRRKALERLQQRKAGTLGARGSPAPSAKTSSMSNSAQHNSSSGAQDAMSRSGQDAIVGSGQQAIARGAHDAMQAATGPGQQHVSIPELPRVELTREQKARIEQNRERALQIQKEQLRTLRDASGPLGPVAVVTQQDRKRLKPEFNPPAIQKKDYIEYDFATMKDSRGGFLDESQKHGLKGPDEEPQSLKDWKEKQKQDLAVKDLAPPLDLSSAPRCVECESLEIDANLKTNFNVRVCRRCMREKPDKYALLTKTECREDYLLTEPELQDTGLLRRIEKPNPHGFLRMQLFLRLQVEEYAWKKWGSAEGLDAEWERREKARLDRREKRYQAKMREMRKKTRAEEYTRKLRNGQGLGDRHTHDWSAPLAVGGNDRLVRRRCVDCGIETEEIII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.67
3 0.71
4 0.72
5 0.72
6 0.73
7 0.71
8 0.71
9 0.71
10 0.68
11 0.68
12 0.65
13 0.65
14 0.57
15 0.54
16 0.46
17 0.43
18 0.38
19 0.34
20 0.35
21 0.31
22 0.3
23 0.28
24 0.27
25 0.23
26 0.21
27 0.24
28 0.24
29 0.26
30 0.27
31 0.28
32 0.33
33 0.32
34 0.34
35 0.35
36 0.37
37 0.35
38 0.34
39 0.3
40 0.26
41 0.27
42 0.25
43 0.2
44 0.17
45 0.16
46 0.18
47 0.19
48 0.19
49 0.17
50 0.15
51 0.15
52 0.16
53 0.16
54 0.14
55 0.12
56 0.11
57 0.11
58 0.11
59 0.1
60 0.1
61 0.1
62 0.09
63 0.1
64 0.09
65 0.08
66 0.09
67 0.1
68 0.09
69 0.1
70 0.1
71 0.1
72 0.09
73 0.09
74 0.09
75 0.08
76 0.09
77 0.09
78 0.09
79 0.09
80 0.1
81 0.1
82 0.11
83 0.12
84 0.15
85 0.17
86 0.18
87 0.21
88 0.21
89 0.21
90 0.22
91 0.22
92 0.23
93 0.26
94 0.29
95 0.34
96 0.36
97 0.38
98 0.4
99 0.44
100 0.49
101 0.5
102 0.56
103 0.51
104 0.58
105 0.63
106 0.61
107 0.56
108 0.53
109 0.51
110 0.47
111 0.46
112 0.45
113 0.42
114 0.44
115 0.44
116 0.42
117 0.39
118 0.35
119 0.34
120 0.29
121 0.26
122 0.24
123 0.24
124 0.22
125 0.2
126 0.17
127 0.15
128 0.11
129 0.1
130 0.09
131 0.09
132 0.07
133 0.08
134 0.16
135 0.18
136 0.27
137 0.3
138 0.32
139 0.38
140 0.43
141 0.48
142 0.49
143 0.57
144 0.58
145 0.6
146 0.63
147 0.59
148 0.63
149 0.58
150 0.51
151 0.42
152 0.35
153 0.35
154 0.32
155 0.31
156 0.23
157 0.21
158 0.23
159 0.22
160 0.19
161 0.17
162 0.16
163 0.14
164 0.16
165 0.15
166 0.13
167 0.13
168 0.14
169 0.11
170 0.15
171 0.23
172 0.2
173 0.24
174 0.26
175 0.25
176 0.24
177 0.27
178 0.25
179 0.18
180 0.21
181 0.18
182 0.22
183 0.23
184 0.24
185 0.21
186 0.22
187 0.23
188 0.22
189 0.21
190 0.22
191 0.28
192 0.36
193 0.45
194 0.47
195 0.49
196 0.54
197 0.6
198 0.6
199 0.57
200 0.51
201 0.45
202 0.41
203 0.37
204 0.32
205 0.25
206 0.19
207 0.14
208 0.11
209 0.1
210 0.09
211 0.1
212 0.11
213 0.14
214 0.14
215 0.13
216 0.14
217 0.14
218 0.15
219 0.14
220 0.13
221 0.12
222 0.13
223 0.13
224 0.12
225 0.12
226 0.11
227 0.11
228 0.1
229 0.09
230 0.07
231 0.11
232 0.14
233 0.15
234 0.22
235 0.26
236 0.33
237 0.38
238 0.44
239 0.46
240 0.52
241 0.59
242 0.6
243 0.67
244 0.66
245 0.69
246 0.72
247 0.69
248 0.63
249 0.62
250 0.55
251 0.51
252 0.46
253 0.42
254 0.37
255 0.38
256 0.35
257 0.3
258 0.29
259 0.23
260 0.24
261 0.26
262 0.22
263 0.2
264 0.22
265 0.2
266 0.19
267 0.19
268 0.16
269 0.11
270 0.11
271 0.11
272 0.15
273 0.15
274 0.16
275 0.22
276 0.28
277 0.33
278 0.38
279 0.44
280 0.47
281 0.5
282 0.51
283 0.48
284 0.44
285 0.46
286 0.43
287 0.39
288 0.31
289 0.3
290 0.29
291 0.28
292 0.29
293 0.21
294 0.18
295 0.15
296 0.16
297 0.19
298 0.2
299 0.2
300 0.2
301 0.2
302 0.19
303 0.2
304 0.24
305 0.2
306 0.19
307 0.2
308 0.2
309 0.2
310 0.21
311 0.2
312 0.17
313 0.16
314 0.16
315 0.15
316 0.16
317 0.19
318 0.23
319 0.33
320 0.42
321 0.5
322 0.6
323 0.68
324 0.74
325 0.82
326 0.85
327 0.84
328 0.85
329 0.84
330 0.83
331 0.84
332 0.84
333 0.84
334 0.86
335 0.85
336 0.85
337 0.84
338 0.83
339 0.77
340 0.79
341 0.77
342 0.76
343 0.78
344 0.77
345 0.79
346 0.76
347 0.74
348 0.68
349 0.65
350 0.64
351 0.57
352 0.54
353 0.52
354 0.5
355 0.52
356 0.53
357 0.5
358 0.44
359 0.42
360 0.37
361 0.28
362 0.26
363 0.23
364 0.2
365 0.17
366 0.15
367 0.14
368 0.14
369 0.16
370 0.14
371 0.17
372 0.18
373 0.2
374 0.28
375 0.3
376 0.35
377 0.38
378 0.42
379 0.42
380 0.46
381 0.48
382 0.44
383 0.46
384 0.46
385 0.42