Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0H904

Protein Details
Accession A0A1A0H904    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-29TKRSRMGCLTCRQRKKRCCETRPQCTECQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences TKRSRMGCLTCRQRKKRCCETRPQCTECQRLRLNCVWPKPGTEHKNKPKEVKSQENMIDHDVYGKIKVLRGIVEYRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.88
5 0.86
6 0.87
7 0.87
8 0.87
9 0.88
10 0.82
11 0.79
12 0.75
13 0.76
14 0.68
15 0.66
16 0.6
17 0.53
18 0.53
19 0.5
20 0.51
21 0.46
22 0.46
23 0.42
24 0.37
25 0.36
26 0.35
27 0.4
28 0.39
29 0.43
30 0.5
31 0.56
32 0.65
33 0.68
34 0.71
35 0.68
36 0.71
37 0.7
38 0.7
39 0.64
40 0.62
41 0.64
42 0.59
43 0.55
44 0.48
45 0.41
46 0.3
47 0.29
48 0.22
49 0.17
50 0.14
51 0.16
52 0.15
53 0.16
54 0.19
55 0.18
56 0.19
57 0.22