Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HBP3

Protein Details
Accession A0A1A0HBP3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-35SDDGWKVQGRKRRNSRKRPERSVIMAHydrophilic
NLS Segment(s)
PositionSequence
18-29GRKRRNSRKRPE
Subcellular Location(s) nucl 16, cyto 7, mito 3
Family & Domain DBs
Amino Acid Sequences MSEILVSNISDDGWKVQGRKRRNSRKRPERSVIMATTTGSVLTDQKGSLGSNPSMRQPSSNLNPFLVLAEISEEDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.21
4 0.29
5 0.37
6 0.47
7 0.56
8 0.64
9 0.73
10 0.81
11 0.88
12 0.91
13 0.93
14 0.92
15 0.88
16 0.83
17 0.77
18 0.71
19 0.61
20 0.52
21 0.41
22 0.32
23 0.25
24 0.19
25 0.13
26 0.08
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.09
36 0.12
37 0.13
38 0.17
39 0.18
40 0.22
41 0.24
42 0.24
43 0.24
44 0.24
45 0.3
46 0.34
47 0.4
48 0.38
49 0.36
50 0.36
51 0.35
52 0.32
53 0.25
54 0.16
55 0.09
56 0.1
57 0.1