Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0H5D4

Protein Details
Accession A0A1A0H5D4    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
250-269QELDKRQRWARDNQWRRHDYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11.833, cyto 8, cyto_mito 5.499, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001578  Peptidase_C12_UCH  
IPR036959  Peptidase_C12_UCH_sf  
IPR017390  Ubiquitinyl_hydrolase_UCH37  
IPR041507  UCH_C  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0016579  P:protein deubiquitination  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF01088  Peptidase_C12  
PF18031  UCH_C  
Amino Acid Sequences MSSGWNTIVSDAGVFTELVSRLGVKDVQIEELYSIDSASLKALAPVHAVVFLFKYGKVDRDSTMHDVPLDGVYDEDYQDKGIFFARQTIQNACATQAVLNSLLNKTSELDIGTELSNIHGFVAGFDPDMCGDTISNSEVIREVHNSFSAPKFIELDDSARPEVDEKNNGLFHFITYLNINNTIYELDGLKRSPIKHDNLLSPDEFYDKLPEVLHRRISKYSDEIRFSLLAITNDKLQQYQALGDELSTAQELDKRQRWARDNQWRRHDYTRLTVELLKDISSSLPDNEWEEVLRKAKLKTMNKSKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.11
4 0.11
5 0.11
6 0.12
7 0.12
8 0.11
9 0.14
10 0.15
11 0.12
12 0.17
13 0.17
14 0.2
15 0.2
16 0.2
17 0.18
18 0.17
19 0.17
20 0.11
21 0.1
22 0.07
23 0.07
24 0.07
25 0.07
26 0.08
27 0.07
28 0.09
29 0.11
30 0.11
31 0.12
32 0.13
33 0.12
34 0.13
35 0.13
36 0.11
37 0.11
38 0.12
39 0.11
40 0.1
41 0.14
42 0.14
43 0.19
44 0.21
45 0.23
46 0.23
47 0.26
48 0.31
49 0.32
50 0.33
51 0.29
52 0.26
53 0.24
54 0.23
55 0.2
56 0.16
57 0.1
58 0.08
59 0.09
60 0.09
61 0.1
62 0.1
63 0.09
64 0.09
65 0.1
66 0.1
67 0.08
68 0.1
69 0.1
70 0.1
71 0.16
72 0.17
73 0.21
74 0.24
75 0.25
76 0.26
77 0.27
78 0.27
79 0.22
80 0.2
81 0.16
82 0.14
83 0.13
84 0.11
85 0.1
86 0.1
87 0.11
88 0.1
89 0.11
90 0.1
91 0.1
92 0.1
93 0.1
94 0.1
95 0.09
96 0.09
97 0.09
98 0.1
99 0.09
100 0.09
101 0.08
102 0.08
103 0.07
104 0.07
105 0.06
106 0.06
107 0.05
108 0.06
109 0.07
110 0.07
111 0.06
112 0.06
113 0.07
114 0.06
115 0.07
116 0.06
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.07
123 0.06
124 0.06
125 0.07
126 0.08
127 0.08
128 0.1
129 0.1
130 0.1
131 0.11
132 0.11
133 0.12
134 0.12
135 0.13
136 0.11
137 0.1
138 0.1
139 0.1
140 0.11
141 0.1
142 0.12
143 0.12
144 0.13
145 0.13
146 0.12
147 0.12
148 0.11
149 0.14
150 0.14
151 0.15
152 0.14
153 0.18
154 0.19
155 0.19
156 0.2
157 0.17
158 0.14
159 0.14
160 0.13
161 0.1
162 0.1
163 0.11
164 0.1
165 0.12
166 0.12
167 0.09
168 0.09
169 0.09
170 0.08
171 0.07
172 0.07
173 0.07
174 0.08
175 0.08
176 0.1
177 0.13
178 0.13
179 0.19
180 0.25
181 0.28
182 0.33
183 0.36
184 0.39
185 0.39
186 0.41
187 0.35
188 0.3
189 0.26
190 0.22
191 0.19
192 0.15
193 0.15
194 0.13
195 0.14
196 0.13
197 0.18
198 0.22
199 0.26
200 0.33
201 0.33
202 0.35
203 0.38
204 0.4
205 0.39
206 0.4
207 0.44
208 0.43
209 0.43
210 0.4
211 0.39
212 0.37
213 0.33
214 0.29
215 0.23
216 0.19
217 0.18
218 0.18
219 0.18
220 0.19
221 0.19
222 0.17
223 0.15
224 0.15
225 0.14
226 0.14
227 0.13
228 0.12
229 0.12
230 0.11
231 0.12
232 0.1
233 0.1
234 0.08
235 0.07
236 0.07
237 0.1
238 0.13
239 0.2
240 0.26
241 0.32
242 0.37
243 0.45
244 0.51
245 0.57
246 0.65
247 0.69
248 0.73
249 0.76
250 0.81
251 0.78
252 0.78
253 0.76
254 0.72
255 0.66
256 0.65
257 0.62
258 0.53
259 0.52
260 0.49
261 0.43
262 0.4
263 0.36
264 0.26
265 0.2
266 0.18
267 0.16
268 0.16
269 0.16
270 0.13
271 0.14
272 0.15
273 0.18
274 0.19
275 0.19
276 0.18
277 0.18
278 0.22
279 0.24
280 0.26
281 0.28
282 0.28
283 0.34
284 0.42
285 0.49
286 0.55