Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HFN3

Protein Details
Accession A0A1A0HFN3    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-33ALPKLPRLKFKKTSRAQANNPCFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, mito_nucl 12.999, nucl 9.5, cyto_mito 9.499, cyto_nucl 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MPYKKVAQPMALPKLPRLKFKKTSRAQANNPCFLLMSSLLNCWAANGEGAAQCSAFAQDLKTCMETHKPVTPPPNPMNYHAQRLYSKFKKVND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.52
3 0.55
4 0.52
5 0.54
6 0.6
7 0.69
8 0.74
9 0.72
10 0.79
11 0.8
12 0.83
13 0.82
14 0.83
15 0.8
16 0.73
17 0.66
18 0.56
19 0.45
20 0.36
21 0.29
22 0.19
23 0.14
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.08
30 0.07
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.05
43 0.05
44 0.05
45 0.06
46 0.08
47 0.1
48 0.11
49 0.11
50 0.12
51 0.17
52 0.2
53 0.22
54 0.27
55 0.28
56 0.31
57 0.39
58 0.41
59 0.44
60 0.46
61 0.51
62 0.47
63 0.5
64 0.55
65 0.52
66 0.56
67 0.5
68 0.5
69 0.46
70 0.49
71 0.55
72 0.51
73 0.56