Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0H7J4

Protein Details
Accession A0A1A0H7J4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-102LKEEDPIKWRRKQNSKRTTAKIKNNNFLAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFKLPARILHFGLVRPFSTSFARLNAPKSSCAAGTVLNLKVRKNGDEPVALEDLEYPEWLWDILDKSKTEAALKEEDPIKWRRKQNSKRTTAKIKNNNFLAQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.26
4 0.24
5 0.25
6 0.25
7 0.21
8 0.21
9 0.25
10 0.25
11 0.27
12 0.31
13 0.3
14 0.29
15 0.29
16 0.28
17 0.23
18 0.22
19 0.19
20 0.14
21 0.14
22 0.16
23 0.16
24 0.19
25 0.2
26 0.19
27 0.23
28 0.23
29 0.24
30 0.22
31 0.23
32 0.21
33 0.22
34 0.23
35 0.21
36 0.2
37 0.17
38 0.15
39 0.13
40 0.11
41 0.09
42 0.08
43 0.05
44 0.04
45 0.05
46 0.05
47 0.04
48 0.05
49 0.07
50 0.1
51 0.12
52 0.13
53 0.15
54 0.16
55 0.17
56 0.17
57 0.17
58 0.18
59 0.2
60 0.2
61 0.23
62 0.24
63 0.24
64 0.27
65 0.32
66 0.36
67 0.39
68 0.47
69 0.53
70 0.62
71 0.71
72 0.78
73 0.82
74 0.85
75 0.87
76 0.88
77 0.89
78 0.88
79 0.88
80 0.87
81 0.85
82 0.84
83 0.8