Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0H8N4

Protein Details
Accession A0A1A0H8N4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
70-97DHQAHCCGKHKVKKRKNKPATPNAYEKQHydrophilic
NLS Segment(s)
PositionSequence
78-88KHKVKKRKNKP
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences VRWTTDVVDNEHLNKKKLKICCIFHPQREFGESSDESLGSSSESSDSSDDEANEHQKEEQSPQNGGGGIDHQAHCCGKHKVKKRKNKPATPNAYEKQPQYKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.45
4 0.49
5 0.54
6 0.54
7 0.56
8 0.62
9 0.68
10 0.69
11 0.7
12 0.7
13 0.63
14 0.56
15 0.54
16 0.46
17 0.36
18 0.34
19 0.27
20 0.23
21 0.21
22 0.19
23 0.16
24 0.15
25 0.14
26 0.07
27 0.07
28 0.05
29 0.05
30 0.06
31 0.06
32 0.07
33 0.07
34 0.08
35 0.09
36 0.08
37 0.09
38 0.1
39 0.12
40 0.12
41 0.12
42 0.11
43 0.12
44 0.13
45 0.15
46 0.19
47 0.18
48 0.19
49 0.19
50 0.2
51 0.19
52 0.18
53 0.15
54 0.11
55 0.1
56 0.13
57 0.13
58 0.12
59 0.14
60 0.14
61 0.15
62 0.19
63 0.25
64 0.31
65 0.39
66 0.5
67 0.59
68 0.68
69 0.79
70 0.85
71 0.89
72 0.91
73 0.93
74 0.93
75 0.93
76 0.93
77 0.88
78 0.87
79 0.78
80 0.76
81 0.7
82 0.64