Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HGX6

Protein Details
Accession A0A1A0HGX6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-60SMPSLHRTNPQQRRRHRRFPKPYLQQLRNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, plas 2
Family & Domain DBs
Amino Acid Sequences MDKAIRSFVHPSLQLRIICPAQDPTERHSRFSMPSLHRTNPQQRRRHRRFPKPYLQQLRNIQILVARAKIYQAHELELNVGPSRQLIGELNKIKLVRHHDLQGLHQKAWRVAGSGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.36
4 0.31
5 0.28
6 0.27
7 0.25
8 0.23
9 0.28
10 0.29
11 0.29
12 0.38
13 0.38
14 0.39
15 0.38
16 0.37
17 0.33
18 0.36
19 0.4
20 0.34
21 0.42
22 0.45
23 0.45
24 0.46
25 0.51
26 0.58
27 0.59
28 0.63
29 0.63
30 0.68
31 0.77
32 0.82
33 0.85
34 0.85
35 0.86
36 0.88
37 0.88
38 0.89
39 0.87
40 0.88
41 0.87
42 0.79
43 0.75
44 0.69
45 0.64
46 0.54
47 0.45
48 0.34
49 0.26
50 0.26
51 0.19
52 0.15
53 0.11
54 0.1
55 0.11
56 0.13
57 0.14
58 0.17
59 0.17
60 0.17
61 0.17
62 0.17
63 0.19
64 0.17
65 0.16
66 0.11
67 0.1
68 0.09
69 0.09
70 0.09
71 0.07
72 0.08
73 0.09
74 0.12
75 0.21
76 0.24
77 0.25
78 0.28
79 0.28
80 0.27
81 0.31
82 0.35
83 0.33
84 0.34
85 0.36
86 0.38
87 0.4
88 0.46
89 0.51
90 0.47
91 0.42
92 0.4
93 0.39
94 0.37
95 0.39
96 0.33
97 0.25