Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7Z329

Protein Details
Accession C7Z329    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
202-223VEKKLKWPLNRWPKEKKYKEIGBasic
NLS Segment(s)
Subcellular Location(s) cyto_mito 10.666, mito 10.5, mito_nucl 9.499, cyto 8.5, cyto_nucl 8.499, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
KEGG nhe:NECHADRAFT_53726  -  
Pfam View protein in Pfam  
PF13489  Methyltransf_23  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences SLTSLRSSVLRVQEENGRTYHSMSSGNIQHNVWLLTLDGELGLSPKIRGPAKRVLDAGTGTGIWAVEYADLHPESEVIGVDLSPIQPSLVPPNCTFEVDDLEKEWTWSQKFDLVLSRVMTGCFVDMQEFVHKAYAHLEPGGYLEMQDLTNPLACDDGTLHEGLELYRLGHLLVEASNKAGRPNNTAPKYKEYLEKAGFIDVVEKKLKWPLNRWPKEKKYKEIGVWTCENLTSGLEGLLLALLTRFLDWKSEEVIAFCTLVRKQLRDTSIHAYIPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.35
4 0.32
5 0.29
6 0.3
7 0.29
8 0.23
9 0.23
10 0.21
11 0.28
12 0.3
13 0.33
14 0.33
15 0.31
16 0.3
17 0.3
18 0.3
19 0.23
20 0.16
21 0.13
22 0.1
23 0.1
24 0.09
25 0.06
26 0.05
27 0.05
28 0.06
29 0.06
30 0.06
31 0.07
32 0.09
33 0.14
34 0.19
35 0.22
36 0.27
37 0.36
38 0.4
39 0.44
40 0.43
41 0.4
42 0.39
43 0.36
44 0.31
45 0.22
46 0.17
47 0.13
48 0.12
49 0.09
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.08
57 0.09
58 0.09
59 0.09
60 0.08
61 0.08
62 0.08
63 0.08
64 0.05
65 0.05
66 0.04
67 0.05
68 0.06
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.14
76 0.18
77 0.21
78 0.22
79 0.27
80 0.28
81 0.28
82 0.28
83 0.2
84 0.21
85 0.19
86 0.19
87 0.15
88 0.17
89 0.16
90 0.16
91 0.16
92 0.15
93 0.15
94 0.15
95 0.15
96 0.16
97 0.16
98 0.17
99 0.2
100 0.18
101 0.19
102 0.19
103 0.19
104 0.16
105 0.16
106 0.14
107 0.1
108 0.08
109 0.06
110 0.06
111 0.05
112 0.05
113 0.06
114 0.08
115 0.08
116 0.08
117 0.1
118 0.1
119 0.1
120 0.12
121 0.12
122 0.11
123 0.1
124 0.1
125 0.08
126 0.08
127 0.09
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.07
137 0.07
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.07
149 0.07
150 0.07
151 0.06
152 0.05
153 0.05
154 0.06
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.07
161 0.07
162 0.08
163 0.09
164 0.09
165 0.12
166 0.16
167 0.16
168 0.22
169 0.3
170 0.39
171 0.44
172 0.5
173 0.51
174 0.53
175 0.54
176 0.49
177 0.48
178 0.43
179 0.46
180 0.41
181 0.41
182 0.35
183 0.33
184 0.31
185 0.23
186 0.25
187 0.18
188 0.2
189 0.2
190 0.19
191 0.19
192 0.26
193 0.31
194 0.29
195 0.34
196 0.41
197 0.51
198 0.6
199 0.66
200 0.7
201 0.76
202 0.83
203 0.84
204 0.82
205 0.8
206 0.78
207 0.77
208 0.76
209 0.71
210 0.65
211 0.61
212 0.53
213 0.45
214 0.37
215 0.32
216 0.22
217 0.17
218 0.12
219 0.09
220 0.08
221 0.07
222 0.07
223 0.06
224 0.05
225 0.05
226 0.04
227 0.03
228 0.04
229 0.04
230 0.05
231 0.06
232 0.06
233 0.1
234 0.11
235 0.13
236 0.16
237 0.19
238 0.19
239 0.19
240 0.21
241 0.19
242 0.18
243 0.16
244 0.18
245 0.16
246 0.23
247 0.26
248 0.26
249 0.31
250 0.38
251 0.42
252 0.41
253 0.46
254 0.46
255 0.47