Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HFD7

Protein Details
Accession A0A1A0HFD7    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26VEQACDSCRKRKLRCSKQFPRCLKCIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences VEQACDSCRKRKLRCSKQFPRCLKCIQHNWCCTYSPRTVRSPLTRAHLTEVENK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.88
4 0.9
5 0.92
6 0.91
7 0.85
8 0.78
9 0.74
10 0.69
11 0.66
12 0.65
13 0.64
14 0.63
15 0.6
16 0.59
17 0.54
18 0.5
19 0.45
20 0.4
21 0.39
22 0.38
23 0.39
24 0.39
25 0.42
26 0.48
27 0.52
28 0.51
29 0.48
30 0.49
31 0.48
32 0.45
33 0.47
34 0.43