Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0H5R7

Protein Details
Accession A0A1A0H5R7    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
80-101RYLQAFKKKKHFHKCCNAAHNPHydrophilic
149-172YYPSWSNISKPRKPRKPAAIGKICHydrophilic
NLS Segment(s)
PositionSequence
158-165KPRKPRKP
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MDITANRTDITGNRTDIMASRTDITNNLADITYNRMDITGNRTDTASNRTDITSNETDITSNRTDIPANRTGSPANRPERYLQAFKKKKHFHKCCNAAHNPIHTCVPRGVVTPSPRAGVCLSCSILRGESSRPSLLTGAQCWRNAHSGYYPSWSNISKPRKPRKPAAIGKIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.22
5 0.19
6 0.16
7 0.17
8 0.17
9 0.18
10 0.18
11 0.19
12 0.18
13 0.17
14 0.16
15 0.14
16 0.13
17 0.13
18 0.18
19 0.16
20 0.14
21 0.14
22 0.13
23 0.13
24 0.15
25 0.2
26 0.21
27 0.21
28 0.21
29 0.22
30 0.23
31 0.24
32 0.27
33 0.23
34 0.18
35 0.18
36 0.18
37 0.19
38 0.19
39 0.24
40 0.2
41 0.19
42 0.19
43 0.18
44 0.17
45 0.17
46 0.2
47 0.14
48 0.13
49 0.12
50 0.12
51 0.14
52 0.16
53 0.21
54 0.23
55 0.24
56 0.24
57 0.25
58 0.25
59 0.27
60 0.29
61 0.31
62 0.3
63 0.29
64 0.3
65 0.31
66 0.36
67 0.38
68 0.4
69 0.38
70 0.43
71 0.49
72 0.52
73 0.6
74 0.63
75 0.68
76 0.72
77 0.76
78 0.75
79 0.79
80 0.84
81 0.81
82 0.8
83 0.74
84 0.69
85 0.63
86 0.59
87 0.49
88 0.41
89 0.38
90 0.3
91 0.28
92 0.22
93 0.21
94 0.16
95 0.16
96 0.17
97 0.19
98 0.22
99 0.24
100 0.25
101 0.24
102 0.23
103 0.23
104 0.22
105 0.18
106 0.17
107 0.16
108 0.16
109 0.15
110 0.16
111 0.15
112 0.15
113 0.15
114 0.14
115 0.14
116 0.18
117 0.21
118 0.21
119 0.21
120 0.22
121 0.21
122 0.23
123 0.23
124 0.22
125 0.25
126 0.28
127 0.31
128 0.3
129 0.32
130 0.33
131 0.31
132 0.31
133 0.28
134 0.28
135 0.27
136 0.3
137 0.29
138 0.26
139 0.29
140 0.27
141 0.27
142 0.33
143 0.41
144 0.45
145 0.55
146 0.64
147 0.71
148 0.78
149 0.84
150 0.85
151 0.86
152 0.88