Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0H4S0

Protein Details
Accession A0A1A0H4S0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
94-123AKAVKTAKSAKQEKKTKQKQAKPEPKTAEQHydrophilic
NLS Segment(s)
PositionSequence
73-117KKKQLQEKKKLLQQKRKELVQAKAVKTAKSAKQEKKTKQKQAKPE
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MNYNEKGIFKGVATIAFKSSKNAVKAIEKYNNAPIDGGASKLKLELVIDPSKKPLTARITANVAPTKEQPDQKKKQLQEKKKLLQQKRKELVQAKAVKTAKSAKQEKKTKQKQAKPEPKTAEQLDQEMADYFNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.25
4 0.25
5 0.24
6 0.29
7 0.3
8 0.3
9 0.31
10 0.32
11 0.36
12 0.41
13 0.46
14 0.48
15 0.44
16 0.44
17 0.49
18 0.47
19 0.39
20 0.34
21 0.26
22 0.23
23 0.21
24 0.2
25 0.13
26 0.12
27 0.12
28 0.12
29 0.12
30 0.08
31 0.08
32 0.08
33 0.13
34 0.19
35 0.21
36 0.21
37 0.24
38 0.24
39 0.24
40 0.22
41 0.24
42 0.22
43 0.26
44 0.28
45 0.27
46 0.31
47 0.31
48 0.34
49 0.3
50 0.24
51 0.21
52 0.2
53 0.22
54 0.22
55 0.26
56 0.31
57 0.38
58 0.45
59 0.51
60 0.58
61 0.58
62 0.64
63 0.7
64 0.72
65 0.73
66 0.76
67 0.75
68 0.74
69 0.79
70 0.78
71 0.78
72 0.78
73 0.78
74 0.75
75 0.71
76 0.72
77 0.69
78 0.64
79 0.62
80 0.61
81 0.51
82 0.54
83 0.52
84 0.45
85 0.42
86 0.45
87 0.42
88 0.44
89 0.52
90 0.52
91 0.61
92 0.7
93 0.77
94 0.81
95 0.85
96 0.86
97 0.88
98 0.87
99 0.88
100 0.9
101 0.91
102 0.86
103 0.86
104 0.82
105 0.77
106 0.76
107 0.68
108 0.65
109 0.56
110 0.52
111 0.44
112 0.37
113 0.32
114 0.26