Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HE07

Protein Details
Accession A0A1A0HE07   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
37-60DDGWKVQGRKRRNSRKRPERSVIMBasic
NLS Segment(s)
PositionSequence
44-55GRKRRNSRKRPE
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MDLAGSLPDAEEDPHMGSKKVGTTVEMSDTLVSNITDDGWKVQGRKRRNSRKRPERSVIMATTTGSILTDQKGSLGSTPSMKNTSSNLNPFLVLAEISEEDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.16
5 0.17
6 0.19
7 0.21
8 0.19
9 0.17
10 0.18
11 0.19
12 0.22
13 0.2
14 0.18
15 0.15
16 0.15
17 0.13
18 0.11
19 0.09
20 0.07
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.09
27 0.1
28 0.12
29 0.16
30 0.23
31 0.29
32 0.39
33 0.49
34 0.58
35 0.67
36 0.76
37 0.84
38 0.88
39 0.91
40 0.9
41 0.85
42 0.79
43 0.73
44 0.67
45 0.56
46 0.47
47 0.38
48 0.29
49 0.23
50 0.18
51 0.13
52 0.08
53 0.08
54 0.07
55 0.07
56 0.08
57 0.07
58 0.07
59 0.08
60 0.09
61 0.09
62 0.11
63 0.11
64 0.15
65 0.16
66 0.19
67 0.2
68 0.2
69 0.21
70 0.21
71 0.28
72 0.3
73 0.33
74 0.33
75 0.32
76 0.31
77 0.29
78 0.28
79 0.2
80 0.14
81 0.1
82 0.1
83 0.09