Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HJF9

Protein Details
Accession A0A1A0HJF9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
101-137QNPTHTLTRNKNQKPNPKNHTRFKRRLEYPRPPGPGTHydrophilic
NLS Segment(s)
PositionSequence
122-125RFKR
Subcellular Location(s) nucl 16, mito 9
Family & Domain DBs
Amino Acid Sequences MPVPISPCCPFPALASRSPLPAWSSTRPSARRRRICLGARRPGHPQKQATRRVSANPLTARHTTNEQNPAHKIQPTKSSPQNPAHKIQTNPQKQPSKSNPQNPTHTLTRNKNQKPNPKNHTRFKRRLEYPRPPGPGTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.36
4 0.37
5 0.36
6 0.34
7 0.27
8 0.27
9 0.29
10 0.29
11 0.34
12 0.36
13 0.44
14 0.49
15 0.56
16 0.62
17 0.68
18 0.71
19 0.72
20 0.75
21 0.76
22 0.78
23 0.79
24 0.78
25 0.77
26 0.71
27 0.66
28 0.68
29 0.67
30 0.66
31 0.63
32 0.61
33 0.6
34 0.66
35 0.73
36 0.68
37 0.64
38 0.59
39 0.55
40 0.54
41 0.48
42 0.44
43 0.38
44 0.36
45 0.35
46 0.35
47 0.32
48 0.27
49 0.28
50 0.25
51 0.26
52 0.33
53 0.29
54 0.3
55 0.31
56 0.33
57 0.31
58 0.3
59 0.28
60 0.22
61 0.3
62 0.3
63 0.34
64 0.38
65 0.42
66 0.46
67 0.53
68 0.59
69 0.54
70 0.56
71 0.56
72 0.55
73 0.51
74 0.52
75 0.54
76 0.53
77 0.55
78 0.59
79 0.6
80 0.57
81 0.65
82 0.65
83 0.66
84 0.67
85 0.71
86 0.71
87 0.7
88 0.75
89 0.69
90 0.66
91 0.61
92 0.59
93 0.58
94 0.57
95 0.61
96 0.64
97 0.69
98 0.72
99 0.76
100 0.8
101 0.8
102 0.83
103 0.83
104 0.84
105 0.85
106 0.87
107 0.89
108 0.89
109 0.89
110 0.88
111 0.89
112 0.87
113 0.89
114 0.89
115 0.88
116 0.87
117 0.86
118 0.83