Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HGP6

Protein Details
Accession A0A1A0HGP6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-41ARSPRRVDQTRRGRHWRKNIKKAGLABasic
NLS Segment(s)
PositionSequence
25-38TRRGRHWRKNIKKA
Subcellular Location(s) extr 12, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MGGMVFLDVNNWVLAARSPRRVDQTRRGRHWRKNIKKAGLADRGISAVGGLSVALVPVCTSHGGNLFGCKIWGTPDTWNPVVLVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.16
3 0.19
4 0.26
5 0.29
6 0.32
7 0.41
8 0.48
9 0.53
10 0.56
11 0.63
12 0.66
13 0.71
14 0.79
15 0.79
16 0.81
17 0.84
18 0.85
19 0.85
20 0.85
21 0.86
22 0.81
23 0.77
24 0.73
25 0.7
26 0.65
27 0.55
28 0.45
29 0.37
30 0.31
31 0.26
32 0.2
33 0.12
34 0.05
35 0.04
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.04
46 0.05
47 0.05
48 0.07
49 0.1
50 0.12
51 0.12
52 0.15
53 0.15
54 0.14
55 0.14
56 0.14
57 0.11
58 0.13
59 0.14
60 0.14
61 0.18
62 0.24
63 0.31
64 0.31
65 0.32