Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HDJ3

Protein Details
Accession A0A1A0HDJ3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-78WSYWCYRCYKCYRRYRCCRRYRCYRRYRCYGCYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, vacu 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016133  Insect_cyst_antifreeze_prot  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVLWCYGVLVLWCFGVLVFWCYGAFGLIGVIDVLVFWCYRCYRCYWSYWCYRCYKCYRRYRCCRRYRCYRRYRCYGCYGLIDVMGATDIMGVIGVVMLQVYRCSRCYCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.08
5 0.08
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.07
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.04
24 0.06
25 0.08
26 0.1
27 0.11
28 0.15
29 0.21
30 0.23
31 0.29
32 0.31
33 0.35
34 0.44
35 0.46
36 0.46
37 0.47
38 0.46
39 0.47
40 0.52
41 0.56
42 0.56
43 0.63
44 0.69
45 0.73
46 0.83
47 0.87
48 0.88
49 0.9
50 0.9
51 0.88
52 0.89
53 0.89
54 0.89
55 0.89
56 0.89
57 0.87
58 0.88
59 0.86
60 0.8
61 0.76
62 0.68
63 0.59
64 0.51
65 0.44
66 0.34
67 0.27
68 0.22
69 0.14
70 0.11
71 0.09
72 0.06
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.03
86 0.06
87 0.09
88 0.12
89 0.14