Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HCU3

Protein Details
Accession A0A1A0HCU3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
105-132ILDKAQKDQKRLQKQSKQLRKKARKLLSHydrophilic
NLS Segment(s)
PositionSequence
114-130KRLQKQSKQLRKKARKL
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MGLSSNVMNMKFMQKAQNSKKNDLHELETKKIRDLSEWLLPSGTVKPKIKPAVTVRTVGYGSIASLTAKENDAISNDNPKSQTAPPSNEPEKTRKDDAQTLLNEILDKAQKDQKRLQKQSKQLRKKARKLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.41
3 0.5
4 0.57
5 0.6
6 0.65
7 0.69
8 0.67
9 0.67
10 0.6
11 0.56
12 0.55
13 0.54
14 0.53
15 0.53
16 0.48
17 0.44
18 0.44
19 0.39
20 0.33
21 0.31
22 0.3
23 0.3
24 0.31
25 0.28
26 0.25
27 0.24
28 0.23
29 0.23
30 0.23
31 0.23
32 0.24
33 0.25
34 0.32
35 0.38
36 0.37
37 0.39
38 0.41
39 0.43
40 0.43
41 0.44
42 0.37
43 0.34
44 0.33
45 0.26
46 0.21
47 0.11
48 0.09
49 0.07
50 0.07
51 0.04
52 0.05
53 0.06
54 0.06
55 0.06
56 0.07
57 0.06
58 0.07
59 0.08
60 0.09
61 0.1
62 0.17
63 0.17
64 0.18
65 0.19
66 0.19
67 0.22
68 0.21
69 0.29
70 0.26
71 0.31
72 0.32
73 0.4
74 0.42
75 0.43
76 0.45
77 0.43
78 0.45
79 0.46
80 0.47
81 0.43
82 0.46
83 0.47
84 0.47
85 0.48
86 0.43
87 0.4
88 0.36
89 0.33
90 0.28
91 0.21
92 0.22
93 0.17
94 0.17
95 0.17
96 0.24
97 0.27
98 0.33
99 0.42
100 0.48
101 0.57
102 0.66
103 0.73
104 0.75
105 0.82
106 0.88
107 0.9
108 0.91
109 0.89
110 0.91
111 0.91
112 0.92