Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HF52

Protein Details
Accession A0A1A0HF52    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MSKTSSKRKPKRRATCKKCSRKDICNPPVRAHydrophilic
NLS Segment(s)
PositionSequence
7-13KRKPKRR
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MSKTSSKRKPKRRATCKKCSRKDICNPPVRAYIRKQPICECLLIYAYMSTQVILRRGWKHVINGNSQKETVAWLKTDKQIPTALRFEHSRTHSSKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.94
4 0.94
5 0.92
6 0.92
7 0.88
8 0.87
9 0.88
10 0.88
11 0.87
12 0.85
13 0.78
14 0.71
15 0.72
16 0.65
17 0.59
18 0.53
19 0.52
20 0.53
21 0.53
22 0.52
23 0.46
24 0.48
25 0.45
26 0.4
27 0.31
28 0.22
29 0.19
30 0.17
31 0.13
32 0.09
33 0.07
34 0.07
35 0.06
36 0.05
37 0.06
38 0.07
39 0.08
40 0.09
41 0.14
42 0.15
43 0.18
44 0.22
45 0.22
46 0.25
47 0.29
48 0.32
49 0.36
50 0.43
51 0.45
52 0.42
53 0.4
54 0.37
55 0.31
56 0.31
57 0.26
58 0.19
59 0.16
60 0.18
61 0.22
62 0.27
63 0.33
64 0.3
65 0.29
66 0.34
67 0.35
68 0.38
69 0.39
70 0.35
71 0.33
72 0.35
73 0.36
74 0.38
75 0.39
76 0.4
77 0.41