Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0H1T1

Protein Details
Accession A0A1A0H1T1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRKKDKRKERKTAFNEDKPWKNHBasic
NLS Segment(s)
PositionSequence
3-11KKDKRKERK
146-150KKKRR
Subcellular Location(s) nucl 14.5, mito_nucl 11, mito 6.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR002048  EF_hand_dom  
IPR000261  EH_dom  
Gene Ontology GO:0005509  F:calcium ion binding  
GO:0016043  P:cellular component organization  
Pfam View protein in Pfam  
PF12763  EF-hand_4  
PROSITE View protein in PROSITE  
PS50222  EF_HAND_2  
PS50031  EH  
CDD cd00052  EH  
Amino Acid Sequences MRKKDKRKERKTAFNEDKPWKNHGDLDVISDSQRKRYEGLWVSNKGLYLDRVATKELHGLDCVSMLNLIHGSVVKKLWSRSNLPRETLQAIWDLVDFRKDGTLNKAEFIVGMWLVDQRLYGRKLPKVVNKLVWSSLGGLGVNVVIKKKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.84
4 0.82
5 0.74
6 0.71
7 0.63
8 0.55
9 0.5
10 0.43
11 0.4
12 0.32
13 0.33
14 0.31
15 0.27
16 0.26
17 0.26
18 0.24
19 0.25
20 0.27
21 0.24
22 0.23
23 0.24
24 0.32
25 0.34
26 0.42
27 0.44
28 0.44
29 0.45
30 0.44
31 0.43
32 0.35
33 0.29
34 0.22
35 0.16
36 0.16
37 0.16
38 0.16
39 0.17
40 0.16
41 0.15
42 0.18
43 0.17
44 0.15
45 0.13
46 0.12
47 0.11
48 0.11
49 0.1
50 0.07
51 0.06
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.06
60 0.07
61 0.08
62 0.1
63 0.11
64 0.16
65 0.18
66 0.23
67 0.31
68 0.41
69 0.42
70 0.42
71 0.42
72 0.41
73 0.4
74 0.35
75 0.27
76 0.18
77 0.16
78 0.14
79 0.12
80 0.11
81 0.08
82 0.09
83 0.08
84 0.07
85 0.1
86 0.1
87 0.11
88 0.16
89 0.22
90 0.21
91 0.22
92 0.22
93 0.19
94 0.19
95 0.18
96 0.13
97 0.07
98 0.06
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.13
106 0.16
107 0.21
108 0.26
109 0.3
110 0.36
111 0.44
112 0.51
113 0.53
114 0.57
115 0.59
116 0.57
117 0.56
118 0.52
119 0.46
120 0.38
121 0.33
122 0.28
123 0.21
124 0.17
125 0.14
126 0.12
127 0.11
128 0.12
129 0.11
130 0.13