Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HJS6

Protein Details
Accession A0A1A0HJS6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRPPKQKPNECPRKPRALRVLRBasic
88-110QSHHQPGKERTLKKNPNKTGVKPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MRPPKQKPNECPRKPRALRVLRALPWPGQTSAAFVVPFAGPAWSVLPRLAARYTSFSMVVFSSVAPFPSPPRAAPYSDPQVPYTTGGQSHHQPGKERTLKKNPNKTGVKPEENTAPAQQAHFNTLPVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.81
4 0.8
5 0.77
6 0.75
7 0.75
8 0.67
9 0.67
10 0.6
11 0.52
12 0.45
13 0.42
14 0.33
15 0.28
16 0.24
17 0.22
18 0.21
19 0.2
20 0.16
21 0.13
22 0.14
23 0.11
24 0.11
25 0.09
26 0.07
27 0.06
28 0.06
29 0.08
30 0.07
31 0.08
32 0.08
33 0.1
34 0.1
35 0.12
36 0.13
37 0.12
38 0.13
39 0.16
40 0.17
41 0.16
42 0.16
43 0.14
44 0.14
45 0.13
46 0.12
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.07
55 0.12
56 0.13
57 0.12
58 0.16
59 0.18
60 0.2
61 0.23
62 0.27
63 0.29
64 0.31
65 0.32
66 0.28
67 0.28
68 0.27
69 0.26
70 0.22
71 0.17
72 0.16
73 0.16
74 0.18
75 0.19
76 0.26
77 0.27
78 0.28
79 0.32
80 0.34
81 0.43
82 0.49
83 0.52
84 0.54
85 0.61
86 0.69
87 0.75
88 0.82
89 0.78
90 0.8
91 0.81
92 0.77
93 0.77
94 0.76
95 0.74
96 0.64
97 0.61
98 0.58
99 0.53
100 0.5
101 0.41
102 0.36
103 0.29
104 0.29
105 0.31
106 0.25
107 0.29
108 0.27