Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HEP3

Protein Details
Accession A0A1A0HEP3    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-66FISSKTDRQHQKKYGKKALNFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10, mito 9, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSIPESPQNPGPFPAQHGYVDVQAKTHKYKDEPTALPGQPSKAQQFISSKTDRQHQKKYGKKALNFLMKTLCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.24
4 0.24
5 0.23
6 0.24
7 0.25
8 0.21
9 0.19
10 0.19
11 0.22
12 0.23
13 0.25
14 0.23
15 0.23
16 0.28
17 0.33
18 0.38
19 0.36
20 0.36
21 0.4
22 0.37
23 0.36
24 0.32
25 0.28
26 0.23
27 0.24
28 0.23
29 0.18
30 0.19
31 0.21
32 0.24
33 0.26
34 0.3
35 0.3
36 0.32
37 0.32
38 0.4
39 0.46
40 0.5
41 0.56
42 0.59
43 0.66
44 0.72
45 0.8
46 0.82
47 0.81
48 0.78
49 0.76
50 0.76
51 0.76
52 0.68
53 0.61