Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HFP2

Protein Details
Accession A0A1A0HFP2   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAQEKRKPFKGKKLHKDLRDYKNQEIBasic
113-144QERRQKIEQSQKDREKKKLSLQQRTRRGQPVMHydrophilic
NLS Segment(s)
PositionSequence
5-20KRKPFKGKKLHKDLRD
94-131AKLARERKEQKREDELRRVQERRQKIEQSQKDREKKKL
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MAQEKRKPFKGKKLHKDLRDYKNQEIKRSLVHRARLRKSYFKLLEKEGIPAGQEYPGLASAAEEDPRKGARDDRHAKTDGSSDDEKQLNFAERAKLARERKEQKREDELRRVQERRQKIEQSQKDREKKKLSLQQRTRRGQPVMGPKISDLLDKIRHNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.87
3 0.89
4 0.88
5 0.87
6 0.87
7 0.81
8 0.79
9 0.79
10 0.75
11 0.71
12 0.65
13 0.57
14 0.54
15 0.53
16 0.53
17 0.5
18 0.55
19 0.57
20 0.63
21 0.67
22 0.68
23 0.69
24 0.69
25 0.67
26 0.69
27 0.68
28 0.65
29 0.62
30 0.58
31 0.57
32 0.49
33 0.46
34 0.36
35 0.29
36 0.23
37 0.19
38 0.15
39 0.1
40 0.1
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.05
47 0.06
48 0.07
49 0.1
50 0.09
51 0.09
52 0.1
53 0.11
54 0.13
55 0.12
56 0.16
57 0.19
58 0.29
59 0.37
60 0.39
61 0.44
62 0.44
63 0.43
64 0.39
65 0.37
66 0.27
67 0.24
68 0.22
69 0.18
70 0.2
71 0.21
72 0.2
73 0.18
74 0.18
75 0.15
76 0.15
77 0.15
78 0.13
79 0.13
80 0.15
81 0.17
82 0.24
83 0.26
84 0.34
85 0.42
86 0.49
87 0.58
88 0.67
89 0.7
90 0.68
91 0.74
92 0.75
93 0.73
94 0.74
95 0.71
96 0.7
97 0.73
98 0.69
99 0.64
100 0.64
101 0.64
102 0.61
103 0.63
104 0.6
105 0.6
106 0.68
107 0.72
108 0.73
109 0.75
110 0.78
111 0.8
112 0.79
113 0.8
114 0.77
115 0.74
116 0.75
117 0.74
118 0.74
119 0.76
120 0.81
121 0.82
122 0.84
123 0.85
124 0.82
125 0.8
126 0.73
127 0.66
128 0.63
129 0.64
130 0.62
131 0.57
132 0.51
133 0.44
134 0.44
135 0.4
136 0.34
137 0.25
138 0.24
139 0.3