Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HEW1

Protein Details
Accession A0A1A0HEW1    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-45IGCHWKDVKHHHKHKGQGPHLBasic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 6.5, cyto_nucl 6, nucl 4.5, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001931  Ribosomal_S21e  
IPR038579  Ribosomal_S21e_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01249  Ribosomal_S21e  
Amino Acid Sequences MLRSITGFFFNFFHKEPHIKKYHIIGCHWKDVKHHHKHKGQGPHLRSINIANIDAEGRAIPGDRATYALSGFIRSRGEAEDFLKILAQQASFFFFLREGLGVQCDSRKGNVYLRKKGFYMSLIKLQPSFDTQCITGSCLKVFCTYCLLCFLLKTDEYAKIKRNQKYKTSNVNFAQARPLAMETPQMLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.34
3 0.37
4 0.45
5 0.49
6 0.48
7 0.5
8 0.56
9 0.57
10 0.53
11 0.54
12 0.55
13 0.53
14 0.6
15 0.59
16 0.51
17 0.5
18 0.56
19 0.61
20 0.61
21 0.66
22 0.66
23 0.7
24 0.77
25 0.81
26 0.81
27 0.79
28 0.78
29 0.72
30 0.71
31 0.67
32 0.59
33 0.52
34 0.43
35 0.39
36 0.31
37 0.27
38 0.18
39 0.16
40 0.16
41 0.15
42 0.13
43 0.07
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.08
55 0.1
56 0.09
57 0.1
58 0.11
59 0.11
60 0.11
61 0.11
62 0.12
63 0.11
64 0.13
65 0.13
66 0.14
67 0.14
68 0.13
69 0.13
70 0.12
71 0.1
72 0.1
73 0.1
74 0.08
75 0.07
76 0.07
77 0.09
78 0.1
79 0.1
80 0.09
81 0.08
82 0.08
83 0.08
84 0.08
85 0.06
86 0.05
87 0.06
88 0.06
89 0.06
90 0.07
91 0.08
92 0.08
93 0.09
94 0.11
95 0.13
96 0.19
97 0.28
98 0.35
99 0.43
100 0.46
101 0.47
102 0.45
103 0.44
104 0.39
105 0.34
106 0.32
107 0.26
108 0.29
109 0.29
110 0.29
111 0.29
112 0.27
113 0.25
114 0.22
115 0.22
116 0.16
117 0.17
118 0.16
119 0.18
120 0.18
121 0.19
122 0.19
123 0.17
124 0.17
125 0.16
126 0.17
127 0.19
128 0.2
129 0.19
130 0.22
131 0.21
132 0.21
133 0.23
134 0.23
135 0.18
136 0.18
137 0.19
138 0.17
139 0.17
140 0.18
141 0.18
142 0.25
143 0.29
144 0.33
145 0.37
146 0.42
147 0.5
148 0.55
149 0.61
150 0.6
151 0.67
152 0.72
153 0.75
154 0.78
155 0.76
156 0.79
157 0.73
158 0.74
159 0.66
160 0.57
161 0.55
162 0.44
163 0.38
164 0.31
165 0.3
166 0.22
167 0.21
168 0.23