Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HG46

Protein Details
Accession A0A1A0HG46   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-86SQQHQHQTPKHKNQKQIKSKSKTKQNKSQKQKQKQSQEQKQNQSHydrophilic
NLS Segment(s)
PositionSequence
54-72KNQKQIKSKSKTKQNKSQK
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
Amino Acid Sequences MRFLKLRPGPGSRIHRRPSAGAAPLILWTRAILPRVQFPTLSSQQHQHQTPKHKNQKQIKSKSKTKQNKSQKQKQKQSQEQKQNQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.63
3 0.61
4 0.59
5 0.56
6 0.52
7 0.46
8 0.37
9 0.33
10 0.27
11 0.27
12 0.25
13 0.18
14 0.12
15 0.09
16 0.11
17 0.12
18 0.13
19 0.12
20 0.12
21 0.18
22 0.21
23 0.21
24 0.19
25 0.18
26 0.24
27 0.27
28 0.28
29 0.24
30 0.24
31 0.27
32 0.33
33 0.35
34 0.33
35 0.34
36 0.43
37 0.52
38 0.59
39 0.66
40 0.66
41 0.74
42 0.78
43 0.83
44 0.84
45 0.85
46 0.84
47 0.82
48 0.87
49 0.86
50 0.87
51 0.87
52 0.85
53 0.85
54 0.86
55 0.88
56 0.89
57 0.9
58 0.9
59 0.91
60 0.93
61 0.92
62 0.92
63 0.92
64 0.93
65 0.93
66 0.93