Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1A0HHU7

Protein Details
Accession A0A1A0HHU7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
90-116TREPLYHVYKKKPRCRRLKTLDVEPYQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MTAVPDLRALKFDSNGCKDLYAICKIHNMPYLVTKGDRLILPYKIRNHNVGDVLKLDRVVTIGSRNFTFNNDKGIPESAFSLTATLTEITREPLYHVYKKKPRCRRLKTLDVEPYQTHLVINELKLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.36
4 0.33
5 0.3
6 0.31
7 0.31
8 0.28
9 0.24
10 0.23
11 0.28
12 0.29
13 0.33
14 0.33
15 0.3
16 0.25
17 0.29
18 0.3
19 0.25
20 0.25
21 0.21
22 0.18
23 0.19
24 0.18
25 0.16
26 0.18
27 0.21
28 0.25
29 0.29
30 0.36
31 0.4
32 0.42
33 0.43
34 0.42
35 0.4
36 0.41
37 0.36
38 0.3
39 0.24
40 0.23
41 0.2
42 0.17
43 0.14
44 0.09
45 0.09
46 0.08
47 0.07
48 0.09
49 0.1
50 0.11
51 0.11
52 0.12
53 0.12
54 0.15
55 0.19
56 0.16
57 0.22
58 0.21
59 0.21
60 0.22
61 0.24
62 0.21
63 0.17
64 0.18
65 0.12
66 0.11
67 0.11
68 0.1
69 0.07
70 0.07
71 0.08
72 0.07
73 0.06
74 0.07
75 0.07
76 0.09
77 0.1
78 0.1
79 0.11
80 0.18
81 0.24
82 0.3
83 0.36
84 0.43
85 0.51
86 0.61
87 0.7
88 0.74
89 0.78
90 0.82
91 0.86
92 0.87
93 0.88
94 0.89
95 0.86
96 0.85
97 0.84
98 0.77
99 0.72
100 0.62
101 0.56
102 0.47
103 0.4
104 0.3
105 0.21
106 0.21
107 0.19