Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HDI9

Protein Details
Accession A0A1A0HDI9   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-35SNDVWKFQGRKRRNSRKRPERSVTMAHydrophilic
NLS Segment(s)
PositionSequence
18-28GRKRRNSRKRP
Subcellular Location(s) nucl 17.5, mito_nucl 11.5, mito 4.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MPDILGSNISNDVWKFQGRKRRNSRKRPERSVTMATTTESTLTDQKGSLGSTPPMKQPSSNLNPFLVLAEISEEDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.25
4 0.36
5 0.41
6 0.52
7 0.61
8 0.7
9 0.77
10 0.84
11 0.9
12 0.91
13 0.94
14 0.93
15 0.88
16 0.84
17 0.79
18 0.74
19 0.64
20 0.56
21 0.46
22 0.36
23 0.3
24 0.23
25 0.17
26 0.12
27 0.11
28 0.1
29 0.1
30 0.1
31 0.09
32 0.09
33 0.1
34 0.1
35 0.1
36 0.1
37 0.12
38 0.16
39 0.17
40 0.21
41 0.24
42 0.24
43 0.24
44 0.26
45 0.34
46 0.38
47 0.42
48 0.4
49 0.37
50 0.37
51 0.36
52 0.33
53 0.24
54 0.15
55 0.1
56 0.1
57 0.1