Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HEY7

Protein Details
Accession A0A1A0HEY7   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
61-86LTCSNFKCYSCNKKNKSKQTLFGTPFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, golg 6, extr 3, E.R. 3, nucl 2, plas 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLASLQSRCFLCIRKHIYRLLVLESELKERNFMLVYYFVFFLFFTHLIVSSEIHENLKHLTCSNFKCYSCNKKNKSKQTLFGTPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.51
4 0.53
5 0.54
6 0.52
7 0.49
8 0.43
9 0.35
10 0.28
11 0.28
12 0.25
13 0.25
14 0.23
15 0.21
16 0.18
17 0.17
18 0.18
19 0.14
20 0.13
21 0.11
22 0.1
23 0.1
24 0.11
25 0.11
26 0.1
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.07
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.08
39 0.1
40 0.1
41 0.11
42 0.11
43 0.11
44 0.13
45 0.14
46 0.13
47 0.13
48 0.16
49 0.21
50 0.25
51 0.31
52 0.35
53 0.33
54 0.38
55 0.46
56 0.54
57 0.58
58 0.65
59 0.66
60 0.72
61 0.82
62 0.87
63 0.9
64 0.87
65 0.86
66 0.84