Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HDV1

Protein Details
Accession A0A1A0HDV1    Localization Confidence High Confidence Score 24
NoLS Segment(s)
PositionSequenceProtein Nature
90-127LCTAPQHRTPRPSRRLPPPPRVARPPHRRPSRFPCPATHydrophilic
131-165DLCRALSSRAPRRPDRRRKRRPKKRPGAAKTSEPPBasic
NLS Segment(s)
PositionSequence
98-120TPRPSRRLPPPPRVARPPHRRPS
139-160RAPRRPDRRRKRRPKKRPGAAK
236-242KKKLRGR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR024758  Inp1  
Gene Ontology GO:0005780  C:extrinsic component of intraperoxisomal membrane  
GO:0045033  P:peroxisome inheritance  
Pfam View protein in Pfam  
PF12634  Inp1  
Amino Acid Sequences MTTHYESPEESPSQIPIPDPHHKSPSQIPITNPHSKFPVMNPHRITPPTPRSPTTSRIRHSSPGPSARRAAPVHHACKHTPCSTKTAPFLCTAPQHRTPRPSRRLPPPPRVARPPHRRPSRFPCPATMPGDLCRALSSRAPRRPDRRRKRRPKKRPGAAKTSEPPAGPAPAGPETCTASAPAALVPPEPPLPSPLPPASSIPQPGGLSPRKQTLMRHQTRGGAVREPLFVSEVKEKKKLRGRLPPAPAPGDVLDGKYSSMLAGQAMEEKTLLFTAPLARVVLYHDKAPGSPVRASPGTLLAHGELEIFQLHGGDVTYVACGRSFVYPLLPRLRVLRTSGCDFVLPLANPQRCWKISIDAADAAVGCRLETVLRRVVQYTSLAVPPPGGPGPTLEPGGPPARSPSLHPPLSNDIPGLAPSNDIPGLAPFNDIPGPAPFNDIRRPPLFNDIPESPPSVPASPLGPGVYPPQAALGAPHAHAPLWPLPRPAHRAGLSLPQAPAPRTAAASSALTNPFFRGPPANVPRPDVLPQPAPPRHRPQAAPSETSSMDSLLDAYEEAVSAGRSVQHSPSRPASRGASYVSAAPSGPLQYHRHIRSDWDGGAAVPSPQPTQGPLADGRPPTALARRDRARHTSCGGRSRQSSVSDLYSTTSSWMEPGVAPRTAKLASSRSLHSVSAHAKGPGPNLDATYRRIYRSIVRQDVCLGAGPGLGGAATAPGTASRAAPDTPRSQATGAGRGIVCPGRRPLDSLPAQRDAHLAPSSPRRHAAATGSRPQRSSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.24
4 0.3
5 0.38
6 0.44
7 0.48
8 0.53
9 0.52
10 0.55
11 0.58
12 0.61
13 0.6
14 0.57
15 0.54
16 0.56
17 0.63
18 0.68
19 0.6
20 0.53
21 0.48
22 0.46
23 0.45
24 0.42
25 0.45
26 0.42
27 0.5
28 0.51
29 0.53
30 0.57
31 0.57
32 0.55
33 0.54
34 0.58
35 0.58
36 0.59
37 0.57
38 0.58
39 0.61
40 0.65
41 0.65
42 0.65
43 0.6
44 0.62
45 0.64
46 0.62
47 0.62
48 0.62
49 0.61
50 0.62
51 0.63
52 0.6
53 0.6
54 0.57
55 0.6
56 0.52
57 0.47
58 0.47
59 0.52
60 0.55
61 0.57
62 0.58
63 0.53
64 0.59
65 0.62
66 0.59
67 0.57
68 0.52
69 0.54
70 0.56
71 0.6
72 0.59
73 0.56
74 0.51
75 0.46
76 0.44
77 0.4
78 0.41
79 0.4
80 0.41
81 0.46
82 0.52
83 0.56
84 0.64
85 0.7
86 0.73
87 0.77
88 0.8
89 0.79
90 0.82
91 0.87
92 0.87
93 0.87
94 0.87
95 0.87
96 0.85
97 0.86
98 0.85
99 0.85
100 0.86
101 0.86
102 0.86
103 0.87
104 0.85
105 0.85
106 0.85
107 0.85
108 0.84
109 0.76
110 0.72
111 0.68
112 0.69
113 0.64
114 0.58
115 0.5
116 0.42
117 0.44
118 0.37
119 0.3
120 0.25
121 0.22
122 0.2
123 0.22
124 0.29
125 0.35
126 0.42
127 0.49
128 0.57
129 0.66
130 0.75
131 0.82
132 0.84
133 0.85
134 0.9
135 0.94
136 0.96
137 0.97
138 0.97
139 0.98
140 0.97
141 0.96
142 0.96
143 0.93
144 0.93
145 0.87
146 0.84
147 0.77
148 0.71
149 0.63
150 0.52
151 0.46
152 0.37
153 0.33
154 0.24
155 0.2
156 0.19
157 0.2
158 0.2
159 0.18
160 0.18
161 0.19
162 0.2
163 0.19
164 0.16
165 0.13
166 0.13
167 0.12
168 0.11
169 0.09
170 0.09
171 0.09
172 0.09
173 0.11
174 0.12
175 0.12
176 0.12
177 0.15
178 0.18
179 0.19
180 0.24
181 0.23
182 0.24
183 0.25
184 0.28
185 0.26
186 0.27
187 0.27
188 0.22
189 0.24
190 0.22
191 0.21
192 0.25
193 0.28
194 0.27
195 0.28
196 0.32
197 0.32
198 0.34
199 0.37
200 0.41
201 0.48
202 0.51
203 0.54
204 0.51
205 0.53
206 0.54
207 0.56
208 0.47
209 0.39
210 0.35
211 0.31
212 0.3
213 0.26
214 0.22
215 0.18
216 0.16
217 0.16
218 0.22
219 0.26
220 0.28
221 0.36
222 0.37
223 0.44
224 0.53
225 0.58
226 0.58
227 0.64
228 0.69
229 0.7
230 0.76
231 0.73
232 0.68
233 0.62
234 0.53
235 0.45
236 0.37
237 0.3
238 0.23
239 0.18
240 0.15
241 0.12
242 0.12
243 0.1
244 0.09
245 0.06
246 0.06
247 0.06
248 0.05
249 0.05
250 0.05
251 0.09
252 0.09
253 0.09
254 0.09
255 0.08
256 0.08
257 0.08
258 0.08
259 0.04
260 0.05
261 0.07
262 0.08
263 0.09
264 0.09
265 0.09
266 0.09
267 0.13
268 0.19
269 0.17
270 0.17
271 0.18
272 0.18
273 0.18
274 0.21
275 0.19
276 0.17
277 0.18
278 0.18
279 0.21
280 0.21
281 0.21
282 0.19
283 0.21
284 0.18
285 0.16
286 0.16
287 0.12
288 0.11
289 0.11
290 0.1
291 0.06
292 0.06
293 0.05
294 0.05
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.03
301 0.04
302 0.04
303 0.04
304 0.04
305 0.05
306 0.04
307 0.05
308 0.06
309 0.06
310 0.07
311 0.07
312 0.12
313 0.14
314 0.18
315 0.22
316 0.22
317 0.22
318 0.24
319 0.26
320 0.23
321 0.24
322 0.25
323 0.24
324 0.26
325 0.27
326 0.24
327 0.21
328 0.2
329 0.18
330 0.16
331 0.13
332 0.13
333 0.19
334 0.19
335 0.2
336 0.22
337 0.26
338 0.23
339 0.26
340 0.24
341 0.21
342 0.22
343 0.24
344 0.24
345 0.19
346 0.19
347 0.16
348 0.15
349 0.11
350 0.09
351 0.07
352 0.04
353 0.04
354 0.04
355 0.04
356 0.06
357 0.09
358 0.13
359 0.14
360 0.15
361 0.16
362 0.16
363 0.17
364 0.16
365 0.15
366 0.12
367 0.11
368 0.11
369 0.1
370 0.1
371 0.09
372 0.1
373 0.08
374 0.07
375 0.06
376 0.07
377 0.1
378 0.11
379 0.11
380 0.09
381 0.09
382 0.12
383 0.13
384 0.12
385 0.1
386 0.11
387 0.12
388 0.13
389 0.16
390 0.22
391 0.28
392 0.29
393 0.29
394 0.3
395 0.34
396 0.35
397 0.32
398 0.23
399 0.16
400 0.15
401 0.15
402 0.14
403 0.08
404 0.07
405 0.07
406 0.08
407 0.08
408 0.07
409 0.07
410 0.06
411 0.07
412 0.07
413 0.07
414 0.06
415 0.07
416 0.07
417 0.07
418 0.08
419 0.08
420 0.09
421 0.09
422 0.12
423 0.12
424 0.14
425 0.19
426 0.19
427 0.23
428 0.24
429 0.26
430 0.24
431 0.32
432 0.3
433 0.27
434 0.3
435 0.28
436 0.28
437 0.27
438 0.28
439 0.2
440 0.2
441 0.21
442 0.16
443 0.14
444 0.13
445 0.13
446 0.11
447 0.11
448 0.1
449 0.08
450 0.09
451 0.11
452 0.11
453 0.1
454 0.09
455 0.09
456 0.09
457 0.09
458 0.09
459 0.09
460 0.09
461 0.1
462 0.11
463 0.1
464 0.1
465 0.1
466 0.12
467 0.15
468 0.18
469 0.19
470 0.21
471 0.23
472 0.28
473 0.34
474 0.34
475 0.35
476 0.31
477 0.32
478 0.31
479 0.36
480 0.34
481 0.3
482 0.28
483 0.25
484 0.25
485 0.24
486 0.24
487 0.18
488 0.16
489 0.15
490 0.15
491 0.13
492 0.13
493 0.13
494 0.13
495 0.14
496 0.15
497 0.15
498 0.15
499 0.15
500 0.15
501 0.14
502 0.14
503 0.14
504 0.15
505 0.24
506 0.31
507 0.37
508 0.37
509 0.4
510 0.4
511 0.4
512 0.39
513 0.33
514 0.29
515 0.25
516 0.28
517 0.34
518 0.38
519 0.41
520 0.45
521 0.51
522 0.53
523 0.55
524 0.54
525 0.51
526 0.57
527 0.55
528 0.52
529 0.45
530 0.43
531 0.38
532 0.37
533 0.3
534 0.2
535 0.15
536 0.12
537 0.11
538 0.07
539 0.06
540 0.05
541 0.05
542 0.05
543 0.04
544 0.04
545 0.05
546 0.05
547 0.05
548 0.05
549 0.07
550 0.08
551 0.1
552 0.15
553 0.21
554 0.24
555 0.29
556 0.37
557 0.41
558 0.41
559 0.43
560 0.41
561 0.37
562 0.37
563 0.34
564 0.28
565 0.23
566 0.24
567 0.21
568 0.18
569 0.15
570 0.13
571 0.12
572 0.1
573 0.11
574 0.14
575 0.17
576 0.22
577 0.31
578 0.33
579 0.36
580 0.36
581 0.39
582 0.4
583 0.41
584 0.36
585 0.29
586 0.26
587 0.23
588 0.23
589 0.19
590 0.14
591 0.1
592 0.11
593 0.1
594 0.1
595 0.11
596 0.11
597 0.15
598 0.14
599 0.16
600 0.17
601 0.19
602 0.24
603 0.24
604 0.24
605 0.21
606 0.22
607 0.21
608 0.26
609 0.3
610 0.3
611 0.38
612 0.44
613 0.49
614 0.54
615 0.6
616 0.59
617 0.57
618 0.57
619 0.57
620 0.57
621 0.59
622 0.58
623 0.55
624 0.53
625 0.53
626 0.53
627 0.47
628 0.43
629 0.37
630 0.37
631 0.31
632 0.29
633 0.26
634 0.21
635 0.19
636 0.17
637 0.15
638 0.11
639 0.11
640 0.11
641 0.1
642 0.1
643 0.15
644 0.18
645 0.2
646 0.2
647 0.2
648 0.24
649 0.23
650 0.23
651 0.23
652 0.23
653 0.25
654 0.29
655 0.31
656 0.32
657 0.34
658 0.33
659 0.29
660 0.31
661 0.3
662 0.3
663 0.3
664 0.27
665 0.28
666 0.29
667 0.32
668 0.3
669 0.29
670 0.26
671 0.26
672 0.3
673 0.29
674 0.31
675 0.36
676 0.34
677 0.34
678 0.34
679 0.35
680 0.38
681 0.46
682 0.51
683 0.52
684 0.51
685 0.5
686 0.51
687 0.5
688 0.42
689 0.34
690 0.24
691 0.15
692 0.14
693 0.12
694 0.09
695 0.07
696 0.06
697 0.04
698 0.03
699 0.04
700 0.04
701 0.04
702 0.04
703 0.04
704 0.06
705 0.07
706 0.08
707 0.09
708 0.11
709 0.13
710 0.17
711 0.22
712 0.25
713 0.29
714 0.31
715 0.32
716 0.3
717 0.35
718 0.35
719 0.37
720 0.33
721 0.33
722 0.31
723 0.29
724 0.32
725 0.31
726 0.29
727 0.26
728 0.32
729 0.31
730 0.32
731 0.37
732 0.37
733 0.42
734 0.49
735 0.53
736 0.53
737 0.56
738 0.56
739 0.52
740 0.5
741 0.41
742 0.39
743 0.32
744 0.28
745 0.27
746 0.36
747 0.41
748 0.42
749 0.44
750 0.41
751 0.42
752 0.44
753 0.47
754 0.47
755 0.5
756 0.56
757 0.61
758 0.61
759 0.6