Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1A0HH13

Protein Details
Accession A0A1A0HH13   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
71-97RYLHEQKKPTQQKIRRPRKSQATPTFGHydrophilic
NLS Segment(s)
PositionSequence
85-87RRP
Subcellular Location(s) nucl 14, mito 9, cyto 2
Family & Domain DBs
Amino Acid Sequences MTFGITWRKCALSCAGIGWAESINLGVLSLISPRNNRSTPRQESSRDRNLHETGIITKQESSRNRNYPRNRYLHEQKKPTQQKIRRPRKSQATPTFGPATCPPAFLPKKSLPRFLPPKWRVRAAPWLSPRAACYMPALCPDYSGFVKRFSAWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.21
4 0.21
5 0.19
6 0.14
7 0.11
8 0.1
9 0.09
10 0.06
11 0.05
12 0.05
13 0.04
14 0.04
15 0.04
16 0.06
17 0.08
18 0.11
19 0.13
20 0.16
21 0.23
22 0.26
23 0.29
24 0.37
25 0.44
26 0.5
27 0.54
28 0.58
29 0.58
30 0.64
31 0.68
32 0.69
33 0.63
34 0.57
35 0.57
36 0.52
37 0.47
38 0.38
39 0.31
40 0.24
41 0.24
42 0.21
43 0.16
44 0.16
45 0.17
46 0.24
47 0.28
48 0.32
49 0.36
50 0.45
51 0.51
52 0.59
53 0.65
54 0.67
55 0.71
56 0.71
57 0.65
58 0.64
59 0.68
60 0.69
61 0.68
62 0.65
63 0.61
64 0.66
65 0.7
66 0.7
67 0.7
68 0.67
69 0.7
70 0.75
71 0.81
72 0.8
73 0.79
74 0.8
75 0.8
76 0.82
77 0.82
78 0.8
79 0.76
80 0.67
81 0.65
82 0.62
83 0.51
84 0.44
85 0.35
86 0.31
87 0.24
88 0.24
89 0.2
90 0.26
91 0.28
92 0.26
93 0.32
94 0.34
95 0.44
96 0.47
97 0.54
98 0.47
99 0.55
100 0.63
101 0.62
102 0.66
103 0.62
104 0.69
105 0.66
106 0.69
107 0.61
108 0.58
109 0.62
110 0.56
111 0.58
112 0.55
113 0.55
114 0.5
115 0.49
116 0.45
117 0.39
118 0.34
119 0.26
120 0.24
121 0.21
122 0.22
123 0.25
124 0.27
125 0.22
126 0.23
127 0.23
128 0.24
129 0.24
130 0.27
131 0.24
132 0.24
133 0.26