Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7YS83

Protein Details
Accession C7YS83    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-31IRTHHITSRKKLQRVRRAAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
KEGG nhe:NECHADRAFT_69635  -  
Amino Acid Sequences MPRTAGLFNCLIRTHHITSRKKLQRVRRAAQQLNVDWLLVRSGGSPGIMFAEGRDAAGLTEWVASVQALRYKDFRCVAKPAPVEDTGKRAMGFDETESVAEFAEEMEGRGLGTWWRRAMGYENGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.44
4 0.47
5 0.54
6 0.64
7 0.67
8 0.69
9 0.72
10 0.76
11 0.77
12 0.8
13 0.78
14 0.77
15 0.78
16 0.75
17 0.73
18 0.68
19 0.59
20 0.54
21 0.48
22 0.37
23 0.27
24 0.23
25 0.18
26 0.11
27 0.1
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.06
35 0.06
36 0.06
37 0.05
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.05
44 0.06
45 0.06
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.07
55 0.08
56 0.1
57 0.13
58 0.14
59 0.19
60 0.23
61 0.24
62 0.24
63 0.29
64 0.3
65 0.34
66 0.35
67 0.32
68 0.32
69 0.33
70 0.33
71 0.28
72 0.3
73 0.24
74 0.24
75 0.22
76 0.18
77 0.17
78 0.15
79 0.15
80 0.12
81 0.13
82 0.12
83 0.12
84 0.13
85 0.12
86 0.1
87 0.08
88 0.07
89 0.05
90 0.06
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.1
99 0.14
100 0.19
101 0.19
102 0.21
103 0.21
104 0.23
105 0.28