Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TIR9

Protein Details
Accession A0A1B7TIR9   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-113LQQRLNQKRIDRLRRKEKRNKALNEGRKKEIBasic
NLS Segment(s)
PositionSequence
47-82DKLRLLKQEKQDAKMEKITKRKEREEQKIEKERLQI
84-111QQRLNQKRIDRLRRKEKRNKALNEGRKK
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MDGLNKSSRTWKAYKVSKSLVPNNSITKKTTWNQKKEQALKDKEFKDKLRLLKQEKQDAKMEKITKRKEREEQKIEKERLQILQQRLNQKRIDRLRRKEKRNKALNEGRKKEINNFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.61
3 0.61
4 0.62
5 0.66
6 0.66
7 0.62
8 0.57
9 0.54
10 0.55
11 0.55
12 0.5
13 0.45
14 0.38
15 0.4
16 0.41
17 0.48
18 0.49
19 0.52
20 0.59
21 0.64
22 0.71
23 0.73
24 0.76
25 0.75
26 0.73
27 0.71
28 0.71
29 0.67
30 0.65
31 0.62
32 0.56
33 0.53
34 0.51
35 0.52
36 0.52
37 0.57
38 0.56
39 0.58
40 0.62
41 0.64
42 0.61
43 0.57
44 0.54
45 0.49
46 0.45
47 0.44
48 0.43
49 0.39
50 0.45
51 0.51
52 0.53
53 0.57
54 0.6
55 0.62
56 0.67
57 0.72
58 0.72
59 0.73
60 0.74
61 0.78
62 0.74
63 0.69
64 0.62
65 0.54
66 0.48
67 0.46
68 0.43
69 0.38
70 0.43
71 0.44
72 0.51
73 0.54
74 0.56
75 0.54
76 0.51
77 0.56
78 0.59
79 0.65
80 0.65
81 0.71
82 0.77
83 0.83
84 0.9
85 0.91
86 0.92
87 0.91
88 0.91
89 0.88
90 0.87
91 0.88
92 0.87
93 0.88
94 0.83
95 0.78
96 0.74
97 0.7