Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TE37

Protein Details
Accession A0A1B7TE37   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
211-255HTSTTRNMKKYNKQYKAPKLNANKISKRQMKKERKNSLDQAKFNKHydrophilic
NLS Segment(s)
PositionSequence
226-245KAPKLNANKISKRQMKKERK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.833, cyto 8, cyto_pero 4.833
Family & Domain DBs
Amino Acid Sequences MGGSNNKGFEFEEFEENVIDLDIGSDNEFDEKHINLTNPNDLQHVITKLRHLDDKVTILDIEVTDYKEKLKKIKVDNERLKADNMKLKNDNNIHIAKIGDLENVVSIITKDIRGLSDYANGISAVVDKRRERTKDDLVNIRNEFTSYIRTLESKIKNHITNTVLSNNLKTSDTNNRIEIYSQLNNTNEIKTPDGETLDYPLKKMMEKIESHTSTTRNMKKYNKQYKAPKLNANKISKRQMKKERKNSLDQAKFNKINQSANSVYPVIKNQKTWNGNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.24
4 0.22
5 0.14
6 0.11
7 0.06
8 0.06
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.09
15 0.09
16 0.09
17 0.11
18 0.11
19 0.13
20 0.16
21 0.17
22 0.2
23 0.24
24 0.29
25 0.29
26 0.29
27 0.28
28 0.26
29 0.27
30 0.26
31 0.27
32 0.24
33 0.23
34 0.26
35 0.28
36 0.3
37 0.33
38 0.3
39 0.3
40 0.3
41 0.32
42 0.29
43 0.27
44 0.24
45 0.2
46 0.19
47 0.15
48 0.14
49 0.12
50 0.13
51 0.13
52 0.13
53 0.17
54 0.19
55 0.22
56 0.27
57 0.32
58 0.38
59 0.46
60 0.56
61 0.62
62 0.69
63 0.76
64 0.75
65 0.73
66 0.67
67 0.61
68 0.55
69 0.49
70 0.45
71 0.39
72 0.38
73 0.39
74 0.39
75 0.44
76 0.43
77 0.41
78 0.38
79 0.37
80 0.31
81 0.28
82 0.26
83 0.18
84 0.17
85 0.15
86 0.1
87 0.08
88 0.08
89 0.07
90 0.07
91 0.06
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.07
100 0.08
101 0.09
102 0.09
103 0.12
104 0.12
105 0.11
106 0.11
107 0.11
108 0.09
109 0.08
110 0.09
111 0.07
112 0.09
113 0.13
114 0.13
115 0.17
116 0.24
117 0.26
118 0.29
119 0.35
120 0.42
121 0.44
122 0.48
123 0.52
124 0.47
125 0.51
126 0.47
127 0.41
128 0.32
129 0.25
130 0.22
131 0.15
132 0.16
133 0.1
134 0.11
135 0.11
136 0.12
137 0.14
138 0.21
139 0.26
140 0.26
141 0.3
142 0.34
143 0.36
144 0.36
145 0.39
146 0.32
147 0.29
148 0.29
149 0.26
150 0.24
151 0.22
152 0.22
153 0.18
154 0.18
155 0.16
156 0.14
157 0.15
158 0.23
159 0.28
160 0.29
161 0.3
162 0.3
163 0.29
164 0.29
165 0.28
166 0.23
167 0.21
168 0.2
169 0.22
170 0.21
171 0.24
172 0.24
173 0.24
174 0.21
175 0.19
176 0.19
177 0.17
178 0.19
179 0.17
180 0.17
181 0.17
182 0.15
183 0.17
184 0.22
185 0.21
186 0.19
187 0.2
188 0.2
189 0.2
190 0.22
191 0.23
192 0.23
193 0.25
194 0.3
195 0.38
196 0.38
197 0.41
198 0.42
199 0.38
200 0.37
201 0.45
202 0.47
203 0.43
204 0.49
205 0.55
206 0.62
207 0.72
208 0.77
209 0.76
210 0.78
211 0.83
212 0.86
213 0.88
214 0.85
215 0.83
216 0.82
217 0.83
218 0.83
219 0.82
220 0.8
221 0.77
222 0.8
223 0.8
224 0.79
225 0.79
226 0.81
227 0.83
228 0.86
229 0.89
230 0.89
231 0.87
232 0.88
233 0.87
234 0.87
235 0.85
236 0.81
237 0.78
238 0.77
239 0.75
240 0.68
241 0.67
242 0.59
243 0.57
244 0.52
245 0.51
246 0.44
247 0.41
248 0.42
249 0.35
250 0.32
251 0.28
252 0.34
253 0.36
254 0.36
255 0.39
256 0.43
257 0.51