Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7T7G3

Protein Details
Accession A0A1B7T7G3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
82-109FLKVNFKSSQLKKKRKFGFKARLKTNGGHydrophilic
NLS Segment(s)
PositionSequence
92-122LKKKRKFGFKARLKTNGGRKVIAKKRFKGRK
Subcellular Location(s) mito 17, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLENIFKRTVSLNIRPLKTVNNTRSISMLLGNRIGTFSNNLAQKQNQYTPTIKNSMISNIEQPIVSSLSPLQSLLQIVTRRFLKVNFKSSQLKKKRKFGFKARLKTNGGRKVIAKKRFKGRKYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.49
4 0.48
5 0.49
6 0.51
7 0.47
8 0.48
9 0.48
10 0.46
11 0.46
12 0.41
13 0.33
14 0.28
15 0.25
16 0.18
17 0.18
18 0.18
19 0.17
20 0.16
21 0.16
22 0.12
23 0.12
24 0.12
25 0.15
26 0.17
27 0.18
28 0.2
29 0.21
30 0.24
31 0.27
32 0.3
33 0.27
34 0.29
35 0.3
36 0.31
37 0.34
38 0.33
39 0.29
40 0.26
41 0.24
42 0.24
43 0.23
44 0.2
45 0.18
46 0.15
47 0.16
48 0.14
49 0.13
50 0.11
51 0.09
52 0.08
53 0.07
54 0.06
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.07
62 0.11
63 0.12
64 0.13
65 0.16
66 0.17
67 0.18
68 0.19
69 0.22
70 0.27
71 0.31
72 0.39
73 0.37
74 0.41
75 0.49
76 0.56
77 0.63
78 0.64
79 0.68
80 0.69
81 0.77
82 0.82
83 0.83
84 0.85
85 0.85
86 0.85
87 0.85
88 0.87
89 0.84
90 0.82
91 0.78
92 0.77
93 0.76
94 0.74
95 0.67
96 0.61
97 0.59
98 0.61
99 0.64
100 0.66
101 0.65
102 0.64
103 0.72
104 0.79
105 0.78
106 0.78