Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7TKC2

Protein Details
Accession A0A1B7TKC2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTQPPLTKVLPKKNRDYYLCHydrophilic
250-269TNDFKFSKQKKRKLLEYLNDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.333, cyto 10.5, nucl 10, cyto_pero 6.166, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
IPR000905  Gcp-like_dom  
IPR017861  KAE1/TsaD  
IPR034680  Kae1_archaea_euk  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0000408  C:EKC/KEOPS complex  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0061711  F:N(6)-L-threonylcarbamoyladenine synthase activity  
GO:0008233  F:peptidase activity  
GO:0006508  P:proteolysis  
GO:0002949  P:tRNA threonylcarbamoyladenosine modification  
Pfam View protein in Pfam  
PF00814  TsaD  
Amino Acid Sequences MTQPPLTKVLPKKNRDYYLCIGLEGSANKLGFGLIKQAVNDPLDTEVISNIRDTYNAPPGEGFMPRDTARHHKNWCCRVLKQVIKEAKEKLGSDFDLKKDVDCIAFTKGPGMGAPLHSVCVFARTLSLLNDIPLVPVNHCIGHIEMGRCVTKGLNPCVLYVSGGNTQIIAYSNNRYRIFGETLDIAVGNCLDRFARVLKISNAPSPGYNIEQLAKKGKHLIELPYTVKGMDLSMSGILQYLEQLTKSFLTNDFKFSKQKKRKLLEYLNDKDVIDSIEITVEDLCFSFQEHLFAMLVEITERAMAHVGANEVLIVGGVGCNMRLQEMMALMCRDRNGKLFATDDRFCIDNGVMIAQAGVLQHRCGYILEKLEDTRVTQTFRTDEVYVNWRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.76
4 0.71
5 0.71
6 0.64
7 0.54
8 0.44
9 0.36
10 0.34
11 0.27
12 0.24
13 0.18
14 0.18
15 0.17
16 0.17
17 0.16
18 0.14
19 0.14
20 0.17
21 0.16
22 0.18
23 0.19
24 0.21
25 0.25
26 0.25
27 0.24
28 0.19
29 0.17
30 0.17
31 0.16
32 0.14
33 0.12
34 0.12
35 0.12
36 0.12
37 0.11
38 0.11
39 0.11
40 0.13
41 0.16
42 0.24
43 0.23
44 0.23
45 0.22
46 0.24
47 0.26
48 0.26
49 0.23
50 0.16
51 0.21
52 0.21
53 0.23
54 0.25
55 0.32
56 0.37
57 0.42
58 0.5
59 0.54
60 0.64
61 0.7
62 0.75
63 0.71
64 0.66
65 0.67
66 0.68
67 0.67
68 0.62
69 0.63
70 0.61
71 0.59
72 0.62
73 0.56
74 0.51
75 0.48
76 0.43
77 0.37
78 0.35
79 0.33
80 0.34
81 0.35
82 0.31
83 0.32
84 0.31
85 0.28
86 0.25
87 0.25
88 0.2
89 0.16
90 0.17
91 0.16
92 0.18
93 0.17
94 0.17
95 0.16
96 0.15
97 0.14
98 0.14
99 0.11
100 0.11
101 0.13
102 0.12
103 0.13
104 0.12
105 0.13
106 0.11
107 0.12
108 0.11
109 0.08
110 0.09
111 0.09
112 0.1
113 0.1
114 0.13
115 0.1
116 0.11
117 0.12
118 0.11
119 0.11
120 0.12
121 0.12
122 0.09
123 0.12
124 0.12
125 0.11
126 0.11
127 0.12
128 0.1
129 0.12
130 0.15
131 0.13
132 0.13
133 0.15
134 0.16
135 0.15
136 0.15
137 0.12
138 0.13
139 0.18
140 0.2
141 0.23
142 0.23
143 0.24
144 0.25
145 0.24
146 0.21
147 0.16
148 0.15
149 0.12
150 0.12
151 0.11
152 0.1
153 0.1
154 0.1
155 0.1
156 0.09
157 0.08
158 0.13
159 0.17
160 0.23
161 0.24
162 0.24
163 0.25
164 0.27
165 0.28
166 0.23
167 0.21
168 0.15
169 0.15
170 0.14
171 0.12
172 0.08
173 0.06
174 0.05
175 0.04
176 0.03
177 0.04
178 0.03
179 0.04
180 0.05
181 0.06
182 0.09
183 0.1
184 0.12
185 0.14
186 0.19
187 0.21
188 0.22
189 0.23
190 0.2
191 0.19
192 0.19
193 0.19
194 0.15
195 0.14
196 0.12
197 0.13
198 0.15
199 0.16
200 0.21
201 0.2
202 0.2
203 0.25
204 0.24
205 0.26
206 0.26
207 0.29
208 0.25
209 0.29
210 0.3
211 0.25
212 0.25
213 0.21
214 0.18
215 0.15
216 0.11
217 0.07
218 0.06
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.06
230 0.06
231 0.07
232 0.08
233 0.08
234 0.1
235 0.12
236 0.18
237 0.19
238 0.25
239 0.27
240 0.28
241 0.36
242 0.42
243 0.5
244 0.53
245 0.61
246 0.66
247 0.7
248 0.76
249 0.78
250 0.81
251 0.78
252 0.79
253 0.75
254 0.68
255 0.62
256 0.54
257 0.44
258 0.35
259 0.27
260 0.17
261 0.12
262 0.08
263 0.08
264 0.07
265 0.08
266 0.07
267 0.06
268 0.06
269 0.06
270 0.06
271 0.05
272 0.06
273 0.08
274 0.08
275 0.1
276 0.1
277 0.11
278 0.11
279 0.11
280 0.1
281 0.08
282 0.08
283 0.06
284 0.06
285 0.05
286 0.05
287 0.05
288 0.06
289 0.06
290 0.06
291 0.07
292 0.08
293 0.08
294 0.08
295 0.08
296 0.07
297 0.06
298 0.06
299 0.05
300 0.04
301 0.03
302 0.03
303 0.03
304 0.03
305 0.04
306 0.04
307 0.05
308 0.06
309 0.06
310 0.06
311 0.07
312 0.09
313 0.1
314 0.12
315 0.13
316 0.13
317 0.14
318 0.16
319 0.17
320 0.17
321 0.21
322 0.22
323 0.23
324 0.26
325 0.28
326 0.32
327 0.37
328 0.37
329 0.34
330 0.32
331 0.3
332 0.27
333 0.26
334 0.2
335 0.15
336 0.14
337 0.14
338 0.12
339 0.11
340 0.11
341 0.08
342 0.09
343 0.07
344 0.09
345 0.09
346 0.1
347 0.11
348 0.12
349 0.13
350 0.13
351 0.16
352 0.18
353 0.24
354 0.25
355 0.27
356 0.28
357 0.31
358 0.31
359 0.3
360 0.31
361 0.28
362 0.29
363 0.28
364 0.32
365 0.31
366 0.32
367 0.34
368 0.3
369 0.29
370 0.3