Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7TII9

Protein Details
Accession A0A1B7TII9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-82SLLINKKPEPSHCKKKKKKSBasic
NLS Segment(s)
PositionSequence
75-82CKKKKKKS
Subcellular Location(s) nucl 13, mito 9, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQRNLLFSGFSNPNSFSFLNFGNVCYGGILYGVKVPIFFFLDKLVYRQKLKKKISLSDFFFLSLLINKKPEPSHCKKKKKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.2
4 0.2
5 0.19
6 0.21
7 0.2
8 0.2
9 0.16
10 0.16
11 0.15
12 0.13
13 0.12
14 0.06
15 0.07
16 0.06
17 0.05
18 0.05
19 0.06
20 0.05
21 0.06
22 0.06
23 0.07
24 0.09
25 0.09
26 0.08
27 0.08
28 0.1
29 0.1
30 0.13
31 0.16
32 0.18
33 0.22
34 0.29
35 0.37
36 0.45
37 0.49
38 0.54
39 0.55
40 0.59
41 0.64
42 0.64
43 0.61
44 0.53
45 0.5
46 0.43
47 0.37
48 0.29
49 0.22
50 0.19
51 0.17
52 0.16
53 0.18
54 0.18
55 0.22
56 0.26
57 0.34
58 0.39
59 0.46
60 0.56
61 0.64
62 0.75