Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7TB75

Protein Details
Accession A0A1B7TB75    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
136-165VDVSHKSIQKNKKRNARREIKELKRHEKIVBasic
NLS Segment(s)
PositionSequence
144-163QKNKKRNARREIKELKRHEK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.833, mito_nucl 11.166, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR000261  EH_dom  
Gene Ontology GO:0016043  P:cellular component organization  
PROSITE View protein in PROSITE  
PS50031  EH  
Amino Acid Sequences KSKKFDENKPWKSHVDLGYITSEEKKRYEGIWVSNKNRFLEMLPQQNHHLKKIYKEEEEDFMVNFVVYEIYNRSNLPPRILCQIYYMIDLKHDGTITKNSFIVGMWLIDQCLYGKKLPAVIPDLVWDSVEKMVIGVDVSHKSIQKNKKRNARREIKELKRHEKIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.45
4 0.39
5 0.37
6 0.34
7 0.31
8 0.29
9 0.27
10 0.24
11 0.24
12 0.24
13 0.23
14 0.23
15 0.29
16 0.28
17 0.34
18 0.42
19 0.49
20 0.52
21 0.56
22 0.59
23 0.53
24 0.49
25 0.41
26 0.32
27 0.32
28 0.34
29 0.38
30 0.36
31 0.37
32 0.4
33 0.46
34 0.46
35 0.4
36 0.4
37 0.33
38 0.37
39 0.45
40 0.47
41 0.43
42 0.45
43 0.45
44 0.41
45 0.41
46 0.35
47 0.25
48 0.19
49 0.16
50 0.12
51 0.1
52 0.07
53 0.05
54 0.04
55 0.05
56 0.06
57 0.07
58 0.09
59 0.09
60 0.11
61 0.18
62 0.19
63 0.21
64 0.21
65 0.21
66 0.26
67 0.26
68 0.25
69 0.19
70 0.21
71 0.18
72 0.19
73 0.18
74 0.12
75 0.12
76 0.12
77 0.11
78 0.09
79 0.09
80 0.07
81 0.08
82 0.15
83 0.16
84 0.16
85 0.16
86 0.15
87 0.15
88 0.15
89 0.14
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.06
98 0.08
99 0.1
100 0.1
101 0.11
102 0.12
103 0.16
104 0.18
105 0.2
106 0.21
107 0.2
108 0.2
109 0.2
110 0.21
111 0.17
112 0.16
113 0.13
114 0.11
115 0.11
116 0.11
117 0.09
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.08
124 0.1
125 0.12
126 0.15
127 0.17
128 0.2
129 0.29
130 0.39
131 0.46
132 0.55
133 0.63
134 0.71
135 0.79
136 0.86
137 0.89
138 0.89
139 0.86
140 0.87
141 0.89
142 0.88
143 0.88
144 0.88
145 0.87