Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YK60

Protein Details
Accession C7YK60   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
97-120VGPKKITKRAPPRGANKRRRTPEDBasic
NLS Segment(s)
PositionSequence
82-116PLKLRLRSRDNRREPVGPKKITKRAPPRGANKRRR
Subcellular Location(s) nucl 15, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
KEGG nhe:NECHADRAFT_74494  -  
Pfam View protein in Pfam  
PF13921  Myb_DNA-bind_6  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MLLPSALSCDASHSSHSSQPRLQPSLFSPPASPPSHAPFANIMTTCRSLQSLLANPAPITDSRAMPSLAQLPTPPLAHAPPPLKLRLRSRDNRREPVGPKKITKRAPPRGANKRRRTPEDDADRYGSESDSASEAPSSPCPPTEPVAPSTPKRTRIAPEQLPLGLERSDFHRMQGNTTTENNSAEAGEEDWTAEDDRILIELVLEKLKLSKTEWQDCARNLGRDRHAVNRRWKSLIMNGDVGLKTRSGRRSKLHSTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.35
4 0.37
5 0.39
6 0.45
7 0.5
8 0.51
9 0.48
10 0.46
11 0.45
12 0.5
13 0.47
14 0.41
15 0.35
16 0.34
17 0.41
18 0.4
19 0.37
20 0.31
21 0.35
22 0.39
23 0.37
24 0.35
25 0.31
26 0.31
27 0.34
28 0.3
29 0.25
30 0.23
31 0.26
32 0.24
33 0.22
34 0.2
35 0.16
36 0.18
37 0.22
38 0.24
39 0.25
40 0.27
41 0.26
42 0.25
43 0.25
44 0.24
45 0.18
46 0.17
47 0.15
48 0.14
49 0.15
50 0.17
51 0.17
52 0.16
53 0.17
54 0.19
55 0.17
56 0.17
57 0.15
58 0.16
59 0.18
60 0.18
61 0.16
62 0.12
63 0.13
64 0.14
65 0.2
66 0.2
67 0.23
68 0.25
69 0.3
70 0.32
71 0.36
72 0.43
73 0.47
74 0.54
75 0.58
76 0.66
77 0.73
78 0.77
79 0.78
80 0.74
81 0.72
82 0.68
83 0.69
84 0.68
85 0.61
86 0.59
87 0.6
88 0.64
89 0.63
90 0.67
91 0.67
92 0.68
93 0.73
94 0.75
95 0.77
96 0.8
97 0.85
98 0.86
99 0.85
100 0.84
101 0.81
102 0.8
103 0.77
104 0.73
105 0.71
106 0.71
107 0.64
108 0.58
109 0.52
110 0.46
111 0.39
112 0.33
113 0.23
114 0.13
115 0.1
116 0.08
117 0.07
118 0.07
119 0.06
120 0.06
121 0.07
122 0.07
123 0.08
124 0.09
125 0.09
126 0.09
127 0.1
128 0.12
129 0.14
130 0.16
131 0.17
132 0.18
133 0.23
134 0.26
135 0.26
136 0.33
137 0.36
138 0.37
139 0.37
140 0.38
141 0.37
142 0.42
143 0.49
144 0.45
145 0.43
146 0.4
147 0.38
148 0.35
149 0.32
150 0.25
151 0.16
152 0.11
153 0.1
154 0.12
155 0.17
156 0.17
157 0.17
158 0.23
159 0.23
160 0.26
161 0.32
162 0.3
163 0.28
164 0.29
165 0.32
166 0.26
167 0.27
168 0.24
169 0.18
170 0.15
171 0.13
172 0.11
173 0.09
174 0.08
175 0.08
176 0.07
177 0.07
178 0.08
179 0.08
180 0.08
181 0.07
182 0.06
183 0.06
184 0.07
185 0.07
186 0.05
187 0.05
188 0.07
189 0.08
190 0.09
191 0.09
192 0.08
193 0.11
194 0.12
195 0.14
196 0.15
197 0.21
198 0.29
199 0.37
200 0.43
201 0.46
202 0.51
203 0.5
204 0.56
205 0.53
206 0.52
207 0.48
208 0.51
209 0.5
210 0.51
211 0.53
212 0.54
213 0.58
214 0.6
215 0.66
216 0.68
217 0.68
218 0.65
219 0.64
220 0.58
221 0.57
222 0.57
223 0.51
224 0.43
225 0.39
226 0.41
227 0.39
228 0.35
229 0.28
230 0.21
231 0.19
232 0.24
233 0.33
234 0.35
235 0.42
236 0.49
237 0.57