Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7T9I4

Protein Details
Accession A0A1B7T9I4    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
103-133TNPELASNKKLKKHKKSKENRKFTKDQNGYYHydrophilic
NLS Segment(s)
PositionSequence
90-124RQERKAKRTRLEITNPELASNKKLKKHKKSKENRK
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MIKLLALIYSKYYLLEKLNENKTIVPKILMPLFIIMEKDGYHLVDEVDIKNLEELQSVTKECMQILEDKLGINKYTMYYASVNKTIAERRQERKAKRTRLEITNPELASNKKLKKHKKSKENRKFTKDQNGYYTRNHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.25
4 0.32
5 0.38
6 0.4
7 0.4
8 0.41
9 0.43
10 0.42
11 0.36
12 0.29
13 0.25
14 0.25
15 0.26
16 0.23
17 0.19
18 0.16
19 0.16
20 0.15
21 0.14
22 0.11
23 0.09
24 0.09
25 0.09
26 0.09
27 0.08
28 0.08
29 0.08
30 0.07
31 0.08
32 0.09
33 0.09
34 0.11
35 0.1
36 0.1
37 0.1
38 0.1
39 0.08
40 0.08
41 0.08
42 0.07
43 0.09
44 0.09
45 0.1
46 0.11
47 0.11
48 0.1
49 0.11
50 0.1
51 0.11
52 0.12
53 0.12
54 0.11
55 0.11
56 0.12
57 0.12
58 0.11
59 0.08
60 0.08
61 0.07
62 0.08
63 0.08
64 0.09
65 0.1
66 0.13
67 0.15
68 0.16
69 0.16
70 0.16
71 0.18
72 0.19
73 0.22
74 0.27
75 0.32
76 0.34
77 0.45
78 0.53
79 0.57
80 0.64
81 0.69
82 0.71
83 0.71
84 0.76
85 0.73
86 0.73
87 0.76
88 0.72
89 0.67
90 0.64
91 0.57
92 0.49
93 0.44
94 0.37
95 0.34
96 0.36
97 0.37
98 0.38
99 0.47
100 0.57
101 0.66
102 0.76
103 0.81
104 0.83
105 0.89
106 0.93
107 0.94
108 0.95
109 0.94
110 0.92
111 0.9
112 0.87
113 0.87
114 0.84
115 0.78
116 0.77
117 0.74
118 0.69