Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7TJS4

Protein Details
Accession A0A1B7TJS4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-34LTGGNKDGKKTKKPSDRIIRNKKNLLKLLNHydrophilic
NLS Segment(s)
PositionSequence
12-26GKKTKKPSDRIIRNK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.333, cyto_mito 4.333, cyto 4, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009582  Spc2/SPCS2  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06703  SPC25  
Amino Acid Sequences MLSVLTGGNKDGKKTKKPSDRIIRNKKNLLKLLNEHLVYILDEEYPDNKSVLSSDFQIFLQFILISISVLSFYLTKKYDFEITKVLQWILVIVYFSINFSTYMYETYIYYYVDDKSILAYKNEEENISIKTKLDYDLDDKKWPSSFVINNKDKIEFKDIVDKDYKKVDYDLLKEKIFKTIINKKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.63
3 0.67
4 0.74
5 0.8
6 0.83
7 0.86
8 0.88
9 0.9
10 0.91
11 0.89
12 0.91
13 0.87
14 0.84
15 0.8
16 0.73
17 0.69
18 0.63
19 0.61
20 0.59
21 0.52
22 0.43
23 0.36
24 0.32
25 0.25
26 0.21
27 0.14
28 0.07
29 0.08
30 0.08
31 0.09
32 0.1
33 0.11
34 0.1
35 0.09
36 0.09
37 0.1
38 0.11
39 0.11
40 0.12
41 0.13
42 0.14
43 0.14
44 0.14
45 0.13
46 0.11
47 0.1
48 0.07
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.09
61 0.1
62 0.11
63 0.12
64 0.13
65 0.19
66 0.19
67 0.21
68 0.22
69 0.22
70 0.24
71 0.24
72 0.22
73 0.16
74 0.15
75 0.13
76 0.08
77 0.07
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.04
86 0.05
87 0.06
88 0.06
89 0.07
90 0.08
91 0.08
92 0.08
93 0.09
94 0.09
95 0.08
96 0.09
97 0.09
98 0.09
99 0.09
100 0.09
101 0.08
102 0.08
103 0.12
104 0.12
105 0.12
106 0.13
107 0.13
108 0.17
109 0.18
110 0.17
111 0.14
112 0.15
113 0.17
114 0.18
115 0.17
116 0.13
117 0.13
118 0.14
119 0.15
120 0.15
121 0.15
122 0.18
123 0.26
124 0.29
125 0.33
126 0.33
127 0.34
128 0.33
129 0.32
130 0.29
131 0.27
132 0.31
133 0.35
134 0.45
135 0.48
136 0.51
137 0.52
138 0.53
139 0.49
140 0.46
141 0.43
142 0.35
143 0.32
144 0.38
145 0.37
146 0.37
147 0.43
148 0.41
149 0.37
150 0.43
151 0.42
152 0.33
153 0.35
154 0.36
155 0.35
156 0.39
157 0.45
158 0.43
159 0.44
160 0.45
161 0.45
162 0.45
163 0.4
164 0.37
165 0.38
166 0.43