Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7TCX1

Protein Details
Accession A0A1B7TCX1    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-54TLLFKKGGKGGKKNNNSRGNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023584  Ribosome_recyc_fac_dom  
IPR036191  RRF_sf  
Pfam View protein in Pfam  
PF01765  RRF  
Amino Acid Sequences MFSKNLSKTFHISSFSLYTKSYNSLPIRQFTTSTLLFKKGGKGGKKNNNSRGNSGDEEDIILEEPGFYTKKYIELQNKEFKFLEKKFQVRKQALDFDPKLLEDLNVGKEGLFRDFATATKKGKVMIVTCFDKKNVNIIINTILARNDLLKMTPEKIPDNEQQLKVNLPPITDAVKKDYENNLKTIGENFKKEIKNQFLSKGEMKIVKELNKKKDALAIEIMKDFEKDHKKFTTKVDDLVKKYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.33
4 0.28
5 0.26
6 0.24
7 0.27
8 0.24
9 0.28
10 0.3
11 0.36
12 0.4
13 0.42
14 0.44
15 0.42
16 0.42
17 0.35
18 0.37
19 0.31
20 0.32
21 0.3
22 0.29
23 0.3
24 0.3
25 0.33
26 0.33
27 0.38
28 0.41
29 0.48
30 0.55
31 0.64
32 0.72
33 0.76
34 0.81
35 0.83
36 0.79
37 0.74
38 0.67
39 0.63
40 0.54
41 0.47
42 0.38
43 0.28
44 0.24
45 0.2
46 0.16
47 0.11
48 0.09
49 0.06
50 0.05
51 0.05
52 0.07
53 0.07
54 0.07
55 0.08
56 0.09
57 0.13
58 0.16
59 0.24
60 0.31
61 0.38
62 0.45
63 0.53
64 0.53
65 0.52
66 0.5
67 0.45
68 0.45
69 0.39
70 0.42
71 0.39
72 0.46
73 0.51
74 0.58
75 0.64
76 0.59
77 0.62
78 0.57
79 0.58
80 0.53
81 0.52
82 0.46
83 0.39
84 0.36
85 0.31
86 0.27
87 0.19
88 0.16
89 0.09
90 0.1
91 0.09
92 0.09
93 0.09
94 0.09
95 0.1
96 0.1
97 0.1
98 0.09
99 0.08
100 0.09
101 0.09
102 0.11
103 0.13
104 0.16
105 0.16
106 0.17
107 0.18
108 0.17
109 0.18
110 0.19
111 0.17
112 0.18
113 0.21
114 0.22
115 0.24
116 0.24
117 0.23
118 0.23
119 0.21
120 0.23
121 0.22
122 0.2
123 0.18
124 0.19
125 0.2
126 0.19
127 0.19
128 0.14
129 0.11
130 0.09
131 0.09
132 0.08
133 0.07
134 0.07
135 0.07
136 0.09
137 0.1
138 0.12
139 0.15
140 0.17
141 0.18
142 0.2
143 0.25
144 0.26
145 0.33
146 0.37
147 0.36
148 0.36
149 0.35
150 0.34
151 0.3
152 0.31
153 0.23
154 0.18
155 0.17
156 0.16
157 0.2
158 0.2
159 0.21
160 0.2
161 0.23
162 0.24
163 0.27
164 0.34
165 0.39
166 0.38
167 0.39
168 0.38
169 0.34
170 0.34
171 0.35
172 0.35
173 0.31
174 0.32
175 0.33
176 0.38
177 0.4
178 0.43
179 0.48
180 0.47
181 0.49
182 0.5
183 0.54
184 0.49
185 0.52
186 0.51
187 0.45
188 0.42
189 0.39
190 0.37
191 0.36
192 0.38
193 0.41
194 0.48
195 0.53
196 0.57
197 0.6
198 0.6
199 0.55
200 0.56
201 0.5
202 0.45
203 0.44
204 0.39
205 0.34
206 0.35
207 0.35
208 0.29
209 0.27
210 0.24
211 0.25
212 0.31
213 0.31
214 0.36
215 0.44
216 0.48
217 0.52
218 0.6
219 0.61
220 0.54
221 0.59
222 0.63
223 0.63