Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7T985

Protein Details
Accession A0A1B7T985    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-123LAEKVEKASRQQRKQRKNRGKKVFGTGKSHydrophilic
NLS Segment(s)
PositionSequence
101-132KASRQQRKQRKNRGKKVFGTGKSLAKKAARRN
Subcellular Location(s) mito 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences SDAITIRTRKVITNPLLARKQFVIDVIHPNRANVSKDELREKLAESYKAEKDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPTYRLVRYGLAEKVEKASRQQRKQRKNRGKKVFGTGKSLAKKAARRNAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.59
4 0.56
5 0.53
6 0.45
7 0.42
8 0.33
9 0.3
10 0.25
11 0.22
12 0.31
13 0.31
14 0.37
15 0.36
16 0.35
17 0.36
18 0.35
19 0.34
20 0.26
21 0.31
22 0.28
23 0.31
24 0.36
25 0.34
26 0.33
27 0.32
28 0.31
29 0.3
30 0.29
31 0.29
32 0.26
33 0.31
34 0.3
35 0.31
36 0.29
37 0.23
38 0.2
39 0.19
40 0.18
41 0.13
42 0.12
43 0.1
44 0.14
45 0.14
46 0.13
47 0.13
48 0.1
49 0.12
50 0.12
51 0.13
52 0.1
53 0.1
54 0.11
55 0.1
56 0.11
57 0.09
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.06
64 0.07
65 0.07
66 0.07
67 0.08
68 0.08
69 0.12
70 0.13
71 0.14
72 0.15
73 0.19
74 0.27
75 0.29
76 0.31
77 0.27
78 0.28
79 0.3
80 0.31
81 0.29
82 0.24
83 0.21
84 0.19
85 0.23
86 0.25
87 0.23
88 0.26
89 0.34
90 0.41
91 0.5
92 0.6
93 0.66
94 0.74
95 0.84
96 0.89
97 0.91
98 0.92
99 0.93
100 0.94
101 0.93
102 0.88
103 0.88
104 0.87
105 0.79
106 0.75
107 0.69
108 0.67
109 0.63
110 0.58
111 0.53
112 0.5
113 0.54
114 0.56