Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z4U5

Protein Details
Accession C7Z4U5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
82-114PAARMKKTKGGQKPRAKPKPKPKPEPKPPGQGTBasic
NLS Segment(s)
PositionSequence
84-134ARMKKTKGGQKPRAKPKPKPKPEPKPPGQGTSVFAQRRREKAAAKAEAKAK
Subcellular Location(s) cyto 18.5, cyto_mito 12.833, mito 6, mito_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
KEGG nhe:NECHADRAFT_76640  -  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MKLANDPRCAPLANLVFFFQHHIFVSQPMGKPHSLQGVMITSDKVLDPLPHVVFGAGVDLSKLTPAQLYALGAGLAAGADAPAARMKKTKGGQKPRAKPKPKPKPEPKPPGQGTSVFAQRRREKAAAKAEAKAKAEAEAAPSSSPSTTSPSAAAAPAKTPAESEPEPEPAAEEAEAAVKKESTLHLILGLRGGMQIFVKTLTGKTITLEVEPSDTIDNVKSKIQDEEASVILQAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.26
4 0.26
5 0.3
6 0.22
7 0.18
8 0.17
9 0.17
10 0.17
11 0.18
12 0.23
13 0.23
14 0.25
15 0.27
16 0.29
17 0.28
18 0.29
19 0.31
20 0.33
21 0.28
22 0.25
23 0.24
24 0.23
25 0.24
26 0.23
27 0.2
28 0.13
29 0.13
30 0.13
31 0.11
32 0.09
33 0.09
34 0.1
35 0.16
36 0.16
37 0.16
38 0.16
39 0.15
40 0.14
41 0.13
42 0.12
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.06
50 0.04
51 0.05
52 0.05
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.04
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.03
69 0.05
70 0.06
71 0.07
72 0.1
73 0.12
74 0.19
75 0.25
76 0.33
77 0.4
78 0.51
79 0.61
80 0.68
81 0.77
82 0.81
83 0.87
84 0.85
85 0.85
86 0.85
87 0.86
88 0.86
89 0.87
90 0.87
91 0.88
92 0.91
93 0.92
94 0.86
95 0.85
96 0.77
97 0.7
98 0.62
99 0.52
100 0.43
101 0.35
102 0.36
103 0.28
104 0.28
105 0.32
106 0.34
107 0.35
108 0.39
109 0.39
110 0.35
111 0.4
112 0.47
113 0.47
114 0.44
115 0.45
116 0.44
117 0.45
118 0.44
119 0.37
120 0.28
121 0.21
122 0.21
123 0.17
124 0.16
125 0.12
126 0.12
127 0.11
128 0.11
129 0.1
130 0.09
131 0.1
132 0.08
133 0.12
134 0.12
135 0.13
136 0.13
137 0.14
138 0.14
139 0.14
140 0.15
141 0.1
142 0.1
143 0.12
144 0.12
145 0.11
146 0.11
147 0.11
148 0.17
149 0.16
150 0.19
151 0.18
152 0.2
153 0.21
154 0.2
155 0.2
156 0.14
157 0.15
158 0.12
159 0.09
160 0.07
161 0.1
162 0.11
163 0.1
164 0.1
165 0.09
166 0.09
167 0.11
168 0.12
169 0.12
170 0.13
171 0.13
172 0.16
173 0.17
174 0.17
175 0.16
176 0.15
177 0.11
178 0.1
179 0.1
180 0.07
181 0.07
182 0.07
183 0.07
184 0.07
185 0.08
186 0.09
187 0.09
188 0.12
189 0.13
190 0.13
191 0.14
192 0.17
193 0.17
194 0.17
195 0.18
196 0.16
197 0.16
198 0.16
199 0.16
200 0.14
201 0.13
202 0.13
203 0.15
204 0.17
205 0.17
206 0.21
207 0.21
208 0.22
209 0.25
210 0.28
211 0.27
212 0.27
213 0.29
214 0.27
215 0.25