Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TE78

Protein Details
Accession A0A1B7TE78   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-34SQTIRKLESIKKKNYYNKPLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011006  CheY-like_superfamily  
IPR001789  Sig_transdc_resp-reg_receiver  
Gene Ontology GO:0000160  P:phosphorelay signal transduction system  
GO:0006950  P:response to stress  
PROSITE View protein in PROSITE  
PS50110  RESPONSE_REGULATORY  
Amino Acid Sequences MDLQLPIISGIEASQTIRKLESIKKKNYYNKPLTPEENELIHKYPISSEDGEEDKENGIQNSKAINSFIPCIIVALTASNTLEDKNLAINSGCNDYLTKPVNLVWLSNKLMEWGYMQSLMTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.15
5 0.16
6 0.2
7 0.28
8 0.37
9 0.43
10 0.51
11 0.58
12 0.66
13 0.74
14 0.8
15 0.81
16 0.8
17 0.77
18 0.75
19 0.73
20 0.69
21 0.63
22 0.58
23 0.5
24 0.43
25 0.38
26 0.34
27 0.3
28 0.26
29 0.21
30 0.16
31 0.15
32 0.14
33 0.15
34 0.13
35 0.12
36 0.14
37 0.15
38 0.16
39 0.15
40 0.14
41 0.11
42 0.11
43 0.12
44 0.09
45 0.09
46 0.08
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.09
54 0.1
55 0.09
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.06
62 0.05
63 0.06
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.08
73 0.08
74 0.08
75 0.08
76 0.1
77 0.11
78 0.14
79 0.13
80 0.12
81 0.13
82 0.13
83 0.19
84 0.21
85 0.2
86 0.17
87 0.18
88 0.23
89 0.23
90 0.24
91 0.21
92 0.24
93 0.26
94 0.26
95 0.25
96 0.21
97 0.22
98 0.2
99 0.18
100 0.15
101 0.15
102 0.15