Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TDJ8

Protein Details
Accession A0A1B7TDJ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
23-55LYLYIPKNSDQKKKKKKKTTKKKKFFLLRYSHVHydrophilic
NLS Segment(s)
PositionSequence
34-46KKKKKKKTTKKKK
Subcellular Location(s) E.R. 8, mito 6, plas 4, extr 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFFFFKVFCFMFFFLTTFVYLLLYLYIPKNSDQKKKKKKKTTKKKKFFLLRYSHVILCPAIHMLPPRKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.12
5 0.11
6 0.09
7 0.08
8 0.07
9 0.06
10 0.05
11 0.06
12 0.07
13 0.08
14 0.08
15 0.1
16 0.18
17 0.23
18 0.33
19 0.41
20 0.51
21 0.62
22 0.72
23 0.81
24 0.84
25 0.9
26 0.91
27 0.94
28 0.95
29 0.95
30 0.95
31 0.93
32 0.92
33 0.91
34 0.88
35 0.87
36 0.84
37 0.78
38 0.74
39 0.69
40 0.6
41 0.5
42 0.43
43 0.33
44 0.25
45 0.2
46 0.15
47 0.11
48 0.12
49 0.19
50 0.23